Bosch Universal MUM59N26CB Kitchen Machine User Manual PDF

1 of 232
1 of 232

Summary of Content for Bosch Universal MUM59N26CB Kitchen Machine User Manual PDF

Register your new device on MyBosch nowandget free benefits:bosch-home.com/ welcome

MUM59...

Universal kitchen machine

[de] Gebrauchsanleitung [en] Instruction manual [fr] Mode demploi [it] Istruzioni per luso [nl] Gebruiksaanwijzing [da] Brugsanvisning [no] Bruksanvisning [sv] Bruksanvisning [fi] Kyttohje [es] Instrucciones de uso [pt] Instrues de servio [el] [tr] Kullanm klavuzu [pl] Instrukcja obsugi [uk] [ru] [ar]

Universal-Kuchenmaschine 10 Universal kitchen machine 22 Robot mnager universel 33 Robot da cucina universale 46 Universele keukenmachine 58 Universalkkkenmaskine 70 Universal kjkkenmaskin 81 Universalkksmaskin 92 Yleiskone 103 Robot de cocina universal 115 Mquina de cozinha universal 128 Kouvo 141 niversal mutfak robotu 155 Uniwersalny robot kuchenny 170 184 197 225

550-2700 g

350-550 g

350-1000 g

100-600 ml 7 1-6 min

5 4-6 min

1 30 s

3 3-6 min

1 30 s

3 5-6 min

1 30 s

3 6-7 min

1 30 s

3 4-5 min

1 30 s

7 4-6 min1-8 x

560-1100 g

350-1000 g

L

1000 g 7

1000 g 5

1000 g 5

1000 g 5

1000 g 6

1000 g 7

1000 g 6

1000 g 5

800 g 7

1000 g 7

1000 g 7

1000 g 6

1000 g 5

1000 g 5

M

5-10 x 10 g 2-4 x 2 sM

300-1000 g 45-120 s7

300-1000 g 45-120 s7

300-1250 g 45-120 s7

300-1250 g 45-120 s7

300-750 g 45-120 s7

150 s71 x

350-1000 g 45-90 s7

N

O

10

de Bestimmungsgemer Gebrauch

Bestimmungsgemer Gebrauch Dieses Gert ist nur fr den privaten Haushalt und das husliche Umfeld bestimmt. Gert nur fr haushaltsbliche Verarbeitungs mengen und zeiten benutzen. Das Gert ist zum Rhren, Kneten und Schlagen von Lebensmitteln geeignet. Das Gert darf nicht zur Verarbeitung von anderen Substanzen bzw. Gegenstnden benutzt werden. Bei Verwendung der vom Hersteller zugelassenen, weiteren Zubehrteile sind zustzliche Anwendungen mglich. Das Gert nur mit zugelassenen Originalteilen und zubehr benutzen. Niemals die Zubehrteile fr andere Gerte verwenden. Das Gert nur in Innenrumen bei Raumtemperatur und bis zu 2000 m ber Meereshhe verwenden.

Wichtige Sicherheitshinweise Die Gebrauchsanleitung sorgfltig durchlesen, danach handeln und aufbewahren! Bei Weitergabe des Gerts diese Anleitung beilegen. Das Nichtbeachten der Anweisungen fr die richtige Anwendung des Gertes schliet eine Haftung des Herstellers fr daraus resultierende Schden aus. Dieses Gert kann von Personen mit reduzierten physischen, sensorischen oder mentalen Fhigkeiten oder Mangel an Erfahrung und/oder Wissen benutzt werden, wenn sie beaufsichtigt oder bezglich des sicheren Gebrauchs des Gertes unterwiesen wurden und die daraus resultierenden Gefahren verstanden haben. Kinder sind vom Gert und der Anschlussleitung fernzuhalten und drfen das Gert nicht bedienen. Kinder drfen nicht mit dem Gert spielen. Reinigung und BenutzerWartung drfen nicht durch Kinder vorgenommen werden.

W Stromschlaggefahr und Brandgefahr! Gert nur gem Angaben auf dem Typenschild anschlieen

und betreiben. Nur benutzen, wenn Zuleitung und Gert keine Beschdigungen aufweisen. Reparaturen am Gert, wie z. B. eine beschdigte Netzanschlussleitung auswechseln, drfen nur durch unseren Kundendienst ausgefhrt werden, um Gefhrdungen zu vermeiden.

Gert ausschlielich mit dem Drehschalter ein und ausschalten. Gert niemals an Zeitschaltuhren oder fernbedienbaren Steckdosen anschlieen. Das Gert whrend des Betriebs stets beaufsichtigen!

11

deWichtige Sicherheitshinweise

Gert nicht auf oder in die Nhe heier Oberflchen, wie z. B. Herdplatten, stellen. Das Netzkabel nicht mit heien Teilen in Berhrung bringen oder ber scharfe Kanten ziehen.

Das Grundgert niemals in Wasser tauchen oder in den Geschirrspler geben. Keinen Dampfreiniger benutzen. Das Gert nicht mit feuchten Hnden benutzen.

Das Gert muss nach jedem Gebrauch, bei nicht vorhandener Aufsicht, vor dem Zusammenbau, Auseinandernehmen oder Reinigen und im Fehlerfall stets vom Netz getrennt werden. W Verletzungsgefahr!

Vor dem Auswechseln von Zubehr oder Zusatzteilen, die im Betrieb bewegt werden, muss das Gert ausgeschaltet und vom Netz getrennt werden. Nach dem Ausschalten luft der Antrieb kurze Zeit nach. Vollstndigen Stillstand des Antriebs abwarten.

Schwenkarm nicht verstellen, whrend das Gert eingeschaltet ist. Werkzeuge nur mit eingesetzter Schssel, angebrachtem

Deckel und aufgesetzten Antriebsschutzdeckeln betreiben! Bei Verwendung von Zubehr Schssel, Deckel und Antriebsschutzdeckel je nach Anweisung anbringen!

Whrend des Betriebes nie mit Hnden in die Schssel oder den Einfllschacht greifen. Keine Gegenstnde (z. B. Kochlffel) in die Schssel oder den Einfllschacht einfhren. Hnde, Haar, Kleidung und andere Utensilien von rotierenden Teilen fern halten.

Niemals Werkzeuge und Zubehr oder 2 Zubehre gleichzeitig verwenden. Bei Gebrauch des Zubehrs sowohl diese, wie auch die jeweils beigelegten Gebrauchsanleitungen beachten.

Zubehr nur im komplett zusammengesetzten Zustand verwenden. Zubehr nie am Grundgert zusammenbauen. Zubehr nur in der dafr vorgesehenen Arbeitsposition verwenden.

Nicht in die scharfen Messer und Kanten der Zerkleinerungsscheiben greifen. Zerkleinerungsscheiben nur am Rand anfassen!

Mixermesser nicht mit bloen Hnden berhren. Niemals in den aufgesetzten Mixer greifen! Mixer nie ohne

aufgesetzten Deckel betreiben. Vorsicht beim Umgang mit den scharfen Messern, bei der

Entleerung des Behlters und bei der Reinigung. W Verbrhungsgefahr!

Beim Verarbeiten von heiem Mixgut tritt Dampf durch den Trichter im Deckel aus.

W Erstickungsgefahr! Kinder nicht mit Verpackungsmaterial spielen lassen.

12

de Wichtige Sicherheitshinweise

W Achtung! Es wird empfohlen, das Gert niemals lnger eingeschaltet zu lassen, wie fr die Verarbeitung der Lebensmittel notwendig. Nicht im Leerlauf betreiben.

W Wichtig! Das Gert nach jeder Verwendung oder nach lngerem Nichtgebrauch unbedingt grndlich reinigen (X Reinigen und Pflegen siehe Seite 17).

W Erluterung der Symbole am Gert bzw. Zubehr

i Anweisungen der Gebrauchsanleitung befolgen.

Y Vorsicht! Rotierende Messer.

W Vorsicht! Rotierende Werkzeuge. Nicht in die Nachfllffnung greifen.

Herzlichen Glckwunsch zum Kauf Ihres neuen Gertes aus dem Hause Bosch. Weitere Informationen zu unseren Produkten finden Sie auf unserer Internetseite.

Inhalt Bestimmungsgemer Gebrauch .............. 10 Wichtige Sicherheitshinweise .................... 10 Sicherheitssysteme .................................... 12 Auf einen Blick ........................................... 13 Arbeitspositionen........................................ 13 Bedienen .................................................... 14 Reinigen und Pflegen ................................. 17 Aufbewahrung ............................................ 18 Hilfe bei Strungen .................................... 18 Anwendungsbeispiele ............................... 19 Sonderzubehr .......................................... 20 Entsorgung ................................................. 21 Garantiebedingungen ................................ 21

Sicherheitssysteme Einschaltsicherung Siehe Tabelle Arbeitspositionen. Das Gert lsst sich in Position 1 und 3 nur einschalten:

wenn die Schssel (11) eingesetzt und bis zum Einrasten gedreht wurde.

Wiedereinschaltsicherung Bei Stromunterbrechung bleibt das Gert eingeschaltet, aber der Motor luft danach nicht wieder an. Zum Wiedereinschalten Drehschalter auf 0/off drehen, dann einschalten.

berlastsicherung Schaltet der Motor whrend der Benutzung selbstndig ab, ist der berlastungsschutz aktiviert. Eine mgliche Ursache kann die gleichzeitige Verarbeitung zu groer Mengen an Lebensmitteln sein. Zum Verhalten bei Aktivierung eines Sicherheitssystems siehe Hilfe bei Strungen. Das Gert ist wartungsfrei.

13

deAuf einen Blick

Auf einen Blick Bild A: Grundgert 1 Entriegelungstaste 2 Schwenkarm

Easy ArmliftFunktion zur Untersttzung der Bewegung des Armes nach oben (siehe Arbeitspositionen).

3 Drehschalter Nach dem Ausschalten (Stellung 0/off) luft das Gert automatisch in die optimale Position zum Wechseln der Werkzeuge. 0/off = Stopp M = Momentschaltung mit hchster Drehzahl, Schalter fr gewnschte Mixdauer festhalten. Stufe 1-7, Arbeitsgeschwindigkeit: 1 = niedrige Drehzahl langsam, 7 = hohe Drehzahl schnell.

4 Betriebsanzeige Leuchtet whrend des Betriebes (Drehschalter auf M oder 1-7). Blinkt bei Fehlern in der Bedienung des Gertes, beim Auslsen der elektronischen Sicherung bzw. bei einem Gertedefekt, siehe Kapitel Hilfe bei Strungen.

5 Antriebsschutzdeckel Zum Abnehmen des Antriebsschutz deckels auf den hinteren Bereich drcken und Deckel abnehmen.

6 Antrieb fr Durchlaufschnitzler und Zitruspresse (Sonderzubehr*). Bei Nichtgebrauch Antriebsschutzdeckel aufsetzen.

7 Antrieb fr Werkzeuge (Rhrbesen, Schlagbesen, Knethaken) und Fleischwolf (Sonderzubehr*)

8 Mixerantriebsschutzdeckel 9 Antrieb fr Mixer (Sonderzubehr*)

Bei Nichtgebrauch Mixerantriebsschutz deckel aufsetzen.

10 Kabelaufrollautomatik Schssel mit Zubehr 11 Edelstahl-Rhrschssel 12 Deckel Werkzeuge 13 Profi Flexi-Rhrbesen 14 Profi Schlagbesen 15 Knethaken mit Teigabweiser

16 Zubehrtasche Zur Aufbewahrung der Werkzeuge und Zerkleinerungsscheiben.

Durchlaufschnitzler 17 Stopfer 18 Deckel mit Einfllschacht 19 Zerkleinerungsscheiben

a Profi Supercut Wendescheibe dick / dnn

b Raspelwendescheibe grob / fein c Reibscheibe fein d SchneidRaspelWendescheibe*

20 Scheibentrger 21 Gehuse mit Auslassffnung Mixer* 22 Mixbecher 23 Deckel 24 Trichter * Wenn ein Zubehrteil nicht im Lieferum fang enthalten ist, kann es ber den Handel und den Kundendienst erworben werden.

Arbeitspositionen Bild B: Achtung! Gert nur betreiben, wenn Werkzeug / Zubehr nach dieser Tabelle am richtigen Antrieb und in der richtigen Position angebracht und in Arbeitsstellung ist. Der Schwenkarm muss in jeder Arbeitsposition eingerastet sein. Hinweis Der Schwenkarm ist mit der Easy Armlift Funktion ausgestattet, welche die Bewegung des Schwenkarmes nach oben untersttzt.

Einstellen der Arbeitsposition: Entriegelungstaste drcken und Schwenk arm bewegen. Bewegung mit einer Hand untersttzen.

Schwenkarm bis zum Einrasten auf die gewnschte Position bewegen.

14

de Bedienen

Position Antrieb Werkzeug/ Zubehr

Arbeits- geschwin- digkeit

1 7

17

15

13

2 7 *

3 6 37

35

4

9 57

7 57

* Einsetzen / Abnehmen von Schlag, Rhr besen und Knethaken.

Bedienen W Verletzungsgefahr!

Netzstecker erst einstecken, wenn alle Vorbereitungen zum Arbeiten mit dem Gert abgeschlossen sind. Achtung! Gert nur mit Zubehr / Werkzeug in Arbeitsstellung betreiben. Gert nicht leer betreiben. Gert und Zubehrteile keinen Hitzequellen aussetzen. Teile sind nicht mikrowellengeeignet.

Gert und Zubehr vor dem ersten Gebrauch grndlich reinigen, siehe Reinigen und Pflegen.

Vorbereiten Grundgert auf glatten und sauberen Untergrund stellen.

Kabel in einem Zug bis zur gewnschten Lnge (max. 100 cm) herausziehen und langsam Ioslassen; das Kabel ist arretiert (Bild C).

KabelArbeitslnge vermindern: Leicht am Kabel ziehen und bis zur gewnschten Lnge aufrollen lassen. Dann erneut leicht am Kabel ziehen und langsam Ioslassen; das Kabel ist arretiert.

Achtung! Wenn sich das Kabel verklemmt, Kabel ganz herausziehen und dann aufrollen lassen.

Netzstecker einstecken.

Schssel und Werkzeuge Beachten Sie die Anwendungsbeispiele in der Tabelle. L

W Verletzungsgefahr durch rotierende Werkzeuge! Whrend des Betriebes nie in die Schssel greifen. Nur mit aufgesetztem Deckel (12) arbeiten! Werkzeug nur bei Stillstand des Antriebes wechseln nach dem Ausschalten luft der Antrieb kurze Zeit nach und bleibt in der Werkzeugwechselposition stehen. Schwenkarm erst nach Stillstand des Werk zeugs bewegen. Nicht genutze Antriebe stets mit den Antriebsschutzdeckeln abdecken. Achtung! Schssel nur fr Arbeiten mit diesem Gert verwenden. Profi Flexi-Rhrbesen (13) zum Rhren von Teig, z. B. Kuch enteig, Obstkuchen usw. und zum Unterheben von Zutaten wie Rosinen und Schokoladenstckchen Profi Schlagbesen (14) zum Schlagen von Eischnee und Sahne (mindestens 30 % Fettgehalt) und zum Mischen von Biskuitteig Knethaken (15) zum Kneten von Teig, z. B. Hefeteig, Brotteig, Pizzateig, Nudelteig, Gebckteig und zum Unterheben von Zutaten wie Saaten in den Teig

15

deBedienen

Wichtiger Hinweis zur Verwendung des Schlagbesens (Bild D): Der Schlagbesen sollte den Schsselboden beinahe berhren, um die Zutaten optimal zu vermischen. Wenn nicht, die Hheneinstellung des Schlagbesens folgendermaen anpassen:

Netzstecker ziehen. Entriegelungstaste drcken und Schwenkarm in Position 2 bringen.

Schlagbesen bis zum Einrasten in den Antrieb einstecken.

Schlagbesen festhalten und Mutter mit Maulschlssel (SW 8) im Uhrzeigersinn lsen.

Hhe des Schlagbesens durch Drehen des Besens auf optimale Hhe einstellen: Im Uhrzeigersinn drehen: Anheben. Gegen den Uhrzeigersinn drehen: Absenken

Entriegelungstaste drcken und Schwenkarm in Position 1 bringen.

Hhe des Schlagbesens berpr fen, wenn erforderlich korrigieren.

Wenn die Hhe korrekt eingestellt ist, Entriegelungstaste drcken und Schwenkarm in Position 2 bringen.

Schlagbesen festhalten und Mutter mit Maulschlssel (SW 8) gegen den Uhrzeigersinn festziehen.

Arbeiten mit der Schssel und den Werkzeugen (Bild E):

Entriegelungstaste drcken und Schwenkarm in Position 2 bringen.

Schssel einsetzen: Nach vorne geneigte Schssel aufsetzen und dann abstellen, gegen den Uhrzeigersinn bis zum Einrasten drehen.

Je nach Verarbeitungsaufgabe Rhr besen, Schlagbesen oder Knethaken bis zum Einrasten in den Antrieb einstecken.

Hinweis: Beim Knethaken Teigabweiser drehen, bis der Knethaken einrasten kann (Bild E-4b).

Die zu verarbeitenden Zutaten in die Schssel einfllen.

Entriegelungstaste drcken und Schwenkarm in Position 1 bringen.

Deckel aufsetzen. Drehschalter auf gewnschte Stufe stellen.

Zutaten nachfllen Gert am Drehschalter ausschalten. Zutaten durch die Nachfllffnung im Deckel nachfllen.

oder Deckel abnehmen. Entriegelungstaste drcken und Schwenkarm in Position 2 bringen.

Zutaten einfllen. Nach der Arbeit

Gert am Drehschalter ausschalten. Netzstecker ziehen. Deckel abnehmen. Entriegelungstaste drcken und Schwenkarm in Position 2 bringen.

Werkzeug aus dem Antrieb nehmen.

Schssel entnehmen. Alle Teile reinigen, siehe Reinigen und Pflegen.

Durchlaufschnitzler Beachten Sie die Anwendungsbeispiele in der Tabelle. M

W Verletzungsgefahr! Nicht in die scharfen Messer und Kanten der Zerkleinerungsscheiben greifen. Zerkleinerungsscheiben nur am Rand anfas sen! Durchlaufschnitzler nur bei Stillstand des Antriebes und bei gezogenem Netzstecker aufsetzen / abnehmen. Nicht in den Einfllschacht greifen. Achtung! Durchlaufschnitzler nur in komplett zusammengesetztem Zustand verwenden. Durchlaufschnitzler nie am Grundgert zusammenbauen. Durchlaufschnitzler nur in der aufgefhrten Betriebsposition betreiben.

16

de Bedienen

Schutz vor berlastung Bild F: Um bei einer berlastung des Durchlaufschnitzlers grere Schden an Ihrem Gert zu verhindern, verfgt die Antriebswelle des Durchlaufschnitzlers ber eine Einkerbung (Sollbruchstelle). Bei berlastung bricht die Antriebswelle an dieser Stelle. Ein neuer Scheibentrger mit Antriebswelle ist beim Kundendienst erhltlich. Profi Supercut Wendescheibe dick / dnn zum Schneiden von Lebensmitteln in dicke oder dnne Scheiben, z. B. Obst und Gemse. Kennzeichnung:

Grob = dicke Scheiben Fein = dnne Scheiben

Hinweis: Nicht geeignet zur Verarbei tung von Hartkse, Brot, Brtchen oder Schokolade. Tipp: Schneiden Sie gekochte Kartoffeln erst nach dem Auskhlen. Raspelwendescheibe grob / fein zum Raspeln von Lebensmitteln in grobe oder feine Stcke, z. B. Obst, Gemse oder Kse, wie Gouda oder Edamer. Kennzeichnung:

2 = grobe Seite 4 = feine Seite

Hinweis: Nicht geeignet zur Verarbeitung von Nssen oder Hartkse, z. B. Parmesan. Tipp: Raspeln Sie Weichkse mit der groben Seite. Reibscheibe fein zum Raspeln von Lebensmitteln fein, z. B. Nsse oder Hartkse, wie Parmesan. Hinweis: Nicht geeignet zur Verarbeitung von Weichkse und Schnittkse. Schneid-Raspel-Wendescheibe zum Reiben roher Kartoffeln oder zum Schneiden in Scheiben. Hinweis: Nicht geeignet zur Verarbeitung von faserigen Lebensmittel, z. B. Lauch oder Mango.

Arbeiten mit dem Durchlaufschnitzler Bild G:

Entriegelungstaste drcken und Schwenkarm in Position 2 bringen.

Schssel einsetzen: Nach vorne geneigte Schssel aufsetzen und dann abstellen, gegen den Uhrzeigersinn bis zum Einrasten drehen.

Entriegelungstaste drcken und Schwenkarm in Position 3 bringen.

Antriebsschutzdeckel vom Antrieb des Durchlaufschnitzlers abnehmen (Bild G-5a).

Scheibentrger am unteren Ende festhalten, dabei mssen die beiden Spitzen nach oben zeigen.

Gewnschte Schneid oder Raspelscheibe vorsichtig auf die Spitzen des Scheibentr gers auflegen (Bild G-6a). Bei WendeScheiben darauf achten, dass die gewnschte Seite nach oben zeigt.

Scheibentrger am oberen Ende ergreifen und in das Gehuse einsetzen (Bild G-6b).

Deckel aufsetzen (Markierung beachten) und im Uhrzeigersinn bis zum Anschlag drehen.

Durchlaufschnitzler wie in Bild G-8 gezeigt auf den Antrieb setzen und im Uhrzeiger sinn bis zum Anschlag drehen.

Drehschalter auf empfohlene Stufe stellen. Zu verarbeitende Lebensmittel in den Einfllschacht geben und mit dem Stopfer nachschieben.

Achtung! Einen Rckstau des Schneidgutes in der Auslassffnung vermeiden. Tipp: Fr gleichmige Schneidergebnisse dnnes Schnittgut bundweise verarbeiten. Hinweis: Sollten zu verarbeitende Lebens mittel im Durchlaufschnitzler festklemmen, Kchenmaschine ausschalten, Netzstecker ziehen, Stillstand des Antriebes abwarten, Deckel des Durchlaufschnitzlers abnehmen und Einfllschacht entleeren. Nach der Arbeit

Gert am Drehschalter ausschalten. Durchlaufschnitzler gegen den Uhrzeiger sinn drehen und abnehmen.

17

de ReinigenundPflegen

Deckel gegen den Uhrzeigersinn drehen und abnehmen.

Scheibentrger mit Scheibe entnehmen. Dazu mit dem Finger von unten gegen die Antriebswelle drcken (Bild H).

Teile reinigen.

Mixer Beachten Sie die Anwendungsbeispiele in der Tabelle. N

W Verletzungsgefahr durch scharfe Messer / rotierenden Antrieb! Nie in den aufgesetzten Mixer greifen! Mixer nur bei Stillstand des Antriebes abnehmen / aufsetzen! Den Mixer nur im zusammen gesetzten Zustand und mit aufgesetztem Deckel betreiben. Mixer nicht leer betreiben.

W Verbrhungsgefahr! Beim Verarbeiten von heiem Mixgut tritt Dampf durch den Trichter im Deckel aus. Arbeiten mit dem Mixer Bild J:

Entriegelungsknopf drcken und Schwenkarm in Position 4 bringen.

Mixerantriebsschutzdeckel abnehmen.

Mixbecher aufsetzen (Markierung am Griff auf Markierung am Grundgert) und gegen den Uhrzeigersinn bis zum Anschlag drehen.

Zutaten einfllen. Maximalmenge flssig = 1,25 Liter; Maximalmenge schumende oder heie Flssigkeiten = 0,75 Liter.

Deckel aufsetzen und gegen den Uhrzeigersinn bis zum Anschlag in den Mixergriff drehen. Der Deckel muss eingerastet sein.

Drehschalter auf gewnschte Stufe stellen. Zutaten nachfllen Bild J-8:

Gert am Drehschalter ausschalten. Deckel abnehmen und Zutaten einfllen

oder Trichter herausnehmen und feste Zutaten nach und nach in Nachfllffnung einfllen

oder flssige Zutaten durch den Trichter einfllen.

Nach der Arbeit Gert am Drehschalter ausschalten. Mixer im Uhrzeigersinn drehen und abnehmen.

Tipp: Mixer am besten sofort nach Gebrauch reinigen.

W Achtung! Durch ungeeignete Lebensmittel kann das Gert beschdigt werden.

Keine heien Lebensmittel ber 70 C im Mixbecher verarbeiten.

Verarbeiten Sie keine gefrorenen Zutaten auer Eiswrfeln, es sei denn, sie wurden in eine ausreichende Menge Flssigkeit gegeben.

Keine Lebensmittel verarbeiten, die harte Bestandteile enthalten. Vor der Verar beitung von Kern und Steinobst (pfel, Pfirsiche usw.) die Kerne oder Steine entfernen.

Hinweise Einschrnkungen fr die Verarbeitung:

Keine Zutaten wie Mandeln, Zwiebeln, Petersilie und Fleisch zerkleinern.

Der Mixer kann Aufstriche wie Erdnussbut ter, Kokosnussbutter oder Nussmus nicht herstellen.

Feste Lebensmittel mit ausreichend Fls sigkeit mischen.

Pulverfrmige Lebensmittel vor dem Mixen mit ausreichend Flssigkeit mischen oder vollstndig in Flssigkeit lsen. Pulverfr mige Lebensmittel sind z. B. Puderzucker, Kakaopulver, gerstete Sojabohnen, Mehl, Eiweipulver.

Reinigen und Pflegen Die verwendeten Zubehrteile mssen nach jedem Gebrauch grndlich gereinigt werden. X Tabelle O Achtung! Keine scheuernden Reinigungsmittel ver wenden. Oberflchen knnen beschdigt werden.

Grundgert reinigen W Stromschlaggefahr!

Grundgert niemals in Wasser tauchen und unter flieendes Wasser halten. Keinen Dampfreiniger verwenden.

18

de Aufbewahrung

Netzstecker ziehen. Grundgert und Antriebsschutzdeckel feucht abwischen. Bei Bedarf etwas Spl mittel benutzen.

Gert anschlieend trockenreiben.

Schssel und Werkzeug reinigen Schssel und Werkzeuge sind splmaschinen fest. Kunststoffteile in der Splmaschine nicht einklemmen, da bleibende Verformungen whrend des Splvorgangs mglich sind!

Durchlaufschnitzler reinigen W Verletzungsgefahr durch scharfe Messer!

Nicht in die scharfen Messer und Kanten der Zerkleinerungsscheiben greifen. Zum Reinigen eine Brste benutzen. Alle Teile des Durchlaufschnitzlers sind splmaschinenfest. Tipp: Zum Entfernen von rotem Belag nach der Verarbeitung von z. B. Karotten etwas Speisel auf ein Tuch geben und den Durch laufschnitzler (nicht die Zerkleinerungs scheiben) damit abreiben. Durchlaufschnitz ler dann splen.

Mixer reinigen W Verletzungsgefahr durch

scharfe Messer! Mixermesser nicht mit bloen Hnden berhren. Mixerbecher, Deckel und Trichter sind splmaschinenfest. Tipp: Nach der Verarbeitung von Flssigkei ten reicht es oft, den Mixer zu reinigen, ohne ihn vom Gert abzunehmen. Dazu 700 ml Wasser mit einem Tropfen Splmittel in den aufgesetzten Mixer geben. Fr ca. 1 Minute den Mixer einschalten (Stufe 7). Splwasser ausschtten und Mixer mit klarem Wasser aussplen. Wichtiger Hinweis: Zubehrtasche bei Bedarf reinigen. Pflegehinweise in der Tasche beachten.

Aufbewahrung W Verletzungsgefahr!

Bei Nichtbenutzung des Gertes den Netzstecker ziehen. Bild K:

Werkzeuge und Zerkleinerungsscheiben in der Zubehrtasche verstauen.

Zubehrtasche in der Schssel aufbewahren.

Hilfe bei Strungen W Verletzungsgefahr!

Vor Behebung einer Strung den Netzstecker ziehen. Wichtiger Hinweis: Ein Fehler in der Bedienung des Gertes, ein Auslsen der elektronischen Sicherungen bzw. ein Gertedefekt wird durch Blinken der Betriebsanzeige angezeigt. Der Schwenkarm muss in jeder Arbeitsposition eingerastet sein. Versuchen Sie als Erstes das aufgetretene Problem an Hand der folgenden Hinweise zu beseitigen. Strung Gert luft nicht an. Abhilfe

Stromversorgung berprfen. Netzstecker berprfen. Schwenkarm kontrollieren. Richtige Position? Eingerastet?

Mixer bzw. Schssel bis zum Anschlag festdrehen.

Mixerdeckel aufsetzen und bis zum Anschlag festdrehen.

Antriebsschutzdeckel an nicht genutzten Antrieben anbringen.

Die Wiedereinschaltsicherung ist aktiv. Gert auf 0/off stellen und dann zurck auf gewnschte Stufe stellen.

Strung Gert schaltet whrend der Benutzung ab. Die berlastsicherung ist aktiviert. Es wurden zu viele Lebensmittel gleichzeitig verarbeitet. Abhilfe

Gert abschalten. Verarbeitungsmenge reduzieren.

19

deAnwendungsbeispiele

Strung Bei laufendem Antrieb wurde versehent lich die Entriegelungstaste bettigt. Der Schwenkarm bewegt sich nach oben. Der Antrieb schaltet ab, bleibt aber nicht in der Werkzeugwechselposition stehen. Abhilfe

Drehschalter auf 0/off stellen. Schwenkarm in Position 1 bringen.

Gert einschalten (Stufe 1). Gert wieder ausschalten.

Werkzeug bleibt in Werkzeugwechsel position stehen. Strung Mixer beginnt nicht zu arbeiten oder bleibt whrend der Benutzung stehen, der Antrieb brummt. Das Messer ist blockiert. Abhilfe

Gert abschalten und Netzstecker ziehen. Mixer abnehmen und das Hindernis entfernen.

Mixer wieder aufsetzen. Gert einschalten.

Wichtiger Hinweis Sollte sich die Strung so nicht beseitigen lassen, wenden Sie sich bitte an den Kundendienst.

Anwendungsbeispiele Beachten Sie die allgemeinen Empfehlungen in den Tabellen. L, M und N. Zulssige Hchstmengen nicht berschreiten.

Biskuitteig Grundrezept 2 Eier 23 EL heies Wasser 100 g Zucker 1 Pckchen Vanillezucker 70 g Mehl 70 g Strkemehl evtl. Backpulver Zutaten (auer Mehl und Strkemehl) ca. 46 Minuten auf Stufe 7 mit dem Schlag besen schaumig schlagen.

Drehschalter auf Stufe 1 stellen und das gesiebte Mehl und Strkemehl in ca. bis 1 Minute lffelweise untermischen.

Hchstmenge: 2 x Grundrezept

Rhrteig Grundrezept 6 Eier 500 g Zucker 1 Prise Salz 2 Pckchen Vanillezucker oder Schale von Zitrone

500 g Butter oder Margarine (Raumtemperatur)

1000 g Mehl 1 Pckchen Backpulver 250 ml Milch Eier, Zucker, Salz und Vanillezucker bzw. Zitronenschale ca. 10 Sekunden auf Stufe 1 mit dem Rhrbesen verrhren.

Auf Stufe 5 stellen und ca. 120 Sekunden verarbeiten.

Butter hinzufgen und ca. 60 Sekunden auf Stufe 3 verarbeiten.

Mehl und Backpulver hinzufgen und ca. 2 Minuten auf Stufe 1 verarbeiten.

Auf Stufe 3 stellen und innerhalb 2 Minuten die Milch nach und nach hinzufgen.

Hchstmenge: 1 x Grundrezept

Schwerer Fruchtkuchen Basic recipe 3 Eier 135 g Zucker 135 g Margarine 255 g Mehl 10 g Backpulver 150 g Korinthen 150 g gemischte Trockenfrchte Rhrbesen einsetzen. Alle Zutaten auer den Trockenfrchten einfllen.

30 Sekunden auf Stufe 1verarbeiten. Dann 35 Minuten auf Stufe 5 verarbeiten. Auf Stufe 2 stellen. Innerhalb von 3060 Sekunden die Tro ckenfrchte dazugeben.

Hchstmenge: 2 x Grundrezept

20

de Sonderzubehr

Mrbeteig Grundrezept 125 g Butter (Raumtemperatur)

100125 g Zucker 1 Ei 1 Prise Salz etwas Zitronenschale oder Vanillezucker 250 g Mehl evtl. Backpulver Alle Zutaten ca. Minute auf Stufe 1, dann ca. 36 Minuten auf Stufe 3 mit dem Rhrbesen verarbeiten.

Ab 250 g Mehl: Zutaten mit dem Knethaken ca. Minute auf Stufe 1, dann ca. 56 Minuten auf Stufe 3 kneten.

Hchstmenge: 2 x Grundrezept

Hefeteig Grundrezept 500 g Mehl 1 Ei 80 g Fett (Raumtemperatur) 80 g Zucker 200250 ml lauwarme Milch 25 g frische Hefe oder 1 Pckchen Trockenhefe

Schale von Zitrone 1 Prise Salz Alle Zutaten ca. Minute auf Stufe 1, dann ca. 36 Minuten auf Stufe 3 mit dem Knethaken verarbeiten.

Hchstmenge: 2 x Grundrezept

Nudelteig Grundrezept 300 g Mehl 3 Eier nach Bedarf 12 EL (1020 g) kaltes Wasser

Alle Zutaten ca. 3 bis 5 Minuten auf Stufe 3 zu einem Teig verarbeiten.

Hchstmenge: 1,5 x Grundrezept

Brotteig Grundrezept 1000 g Mehl 2 Pckchen Trockenhefe 2 TL Salz 600650 ml warmes Wasser Alle Zutaten ca. Minute auf Stufe 1, dann ca. 67 Minuten auf Stufe 3 mit dem Knethaken verarbeiten.

Mayonnaise 1 Ei 1 TL Senf l l 1 EL Zitronensaft oder Essig 1 Prise Salz 1 Prise Zucker

Zutaten mssen Zimmertemperatur haben. Zubereitung von Mayonnaise ist nur mit ganzen Eiern mglich.

Zutaten (auer l) einige Sekunden auf Stufe 3 oder 4 im Mixer verarbeiten.

Mixer auf Stufe 7 schalten und das l langsam durch den Trichter gieen und so lange weiter mischen, bis die Mayonnaise emulgiert.

Mayonnaise bald verbrauchen, nicht aufbewahren.

Sonderzubehr Zubehr knnen Sie beim Kundendienst, im Fachhandel oder im Internet kaufen. Ver wenden Sie nur Originalzubehr, da dieses genau auf Ihr Gert abgestimmt ist. Zubehr ist gertespezifisch. Geben Sie beim Kauf immer die genaue Bezeichnung (ENr.) Ihres Gerts an. Welches Zubehr fr Ihr Gert verfgbar ist, erfahren Sie in unserem Katalog, im Online Shop oder beim Kundendienst. www.bosch-home.com

21

deEntsorgung

Entsorgung

J Entsorgen Sie die Verpackung um weltgerecht. Dieses Gert ist ent sprechend der europischen Richtlinie 2012/19/EU ber Elektro- und Elektronikaltgerte (waste electrical and electronic equip- ment WEEE) gekennzeichnet. Die Richtlinie gibt den Rahmen fr eine EU-weit gltige Rcknahme und Verwertung der Altgerte vor. ber aktuelle Entsorgungswege bitte beim Fachhndler informieren.

Garantiebedingungen Fr dieses Gert gelten die von unserer jeweils zustndigen Landes vertretung herausgegebenen Garantie bedingungen des Landes, in dem das Gert gekauft wurde. Sie knnen die Garantiebedin gungen jederzeit ber Ihren Fachhndler, bei dem Sie das Gert gekauft haben, oder direkt bei unserer Landesvertretung anfordern. Die Garantie bedingungen fr Deutschland und die Adressen finden Sie auf den letzten vier Seiten dieses Heftes. Darber hinaus sind die Garantie bedingungen auch im Internet unter der benannten Webadresse hinterlegt. Fr die Inanspruchnahme von Garantie leistungen ist in jedem Fall die Vorlage des Kauf beleges erforderlich.

nderungen vorbehalten.

22

en Intended use

Intended use This appliance is intended for domestic use only. Use the appliance only for processing normal amounts of food and for normal amounts of time for domestic use. The appliance is suitable for mixing, kneading and beating food. The appliance must not be used for processing other substances or objects. Additional applications are possible if the accessories approved by the manufacturer are used. Only use the appliance with approved genuine parts and accessories. Never use the accessory parts for other appliances. Only use the appliance indoors at room temperature and up to 2000 m above sea level.

Important safety information Read and follow the instruction manual carefully and keep for later reference! Enclose these instructions when you give this appliance to someone else. If the instructions for correct use of the appliance are not observed, the manufacturers liability for any resulting damage will be excluded. This appliance can be used by persons with reduced physical, sensory or mental capabilities or lack of experience and/or knowledge if they have been given supervision or instruction concerning use of the appliance in a safe way and if they understand the hazards involved. Keep children away from the appliance and connecting cable and do not allow them to use the appliance. Do not let children play with the appliance. Cleaning and user maintenance must not be performed by children.

W Risk of electric shock and fire! Connect and operate the appliance only in accordance with the

specifications on the rating plate. Do not use the appliance if the power cord and/or appliance are damaged. Only our customer service may repair the appliance, e.g. by replacing a damaged power cord, in order to avoid hazards.

Use only the rotary switch to switch the appliance on or off. Never connect the appliance to timer switches or remote controllable sockets. Never leave the appliance unattended while it is switched on!

Do not place the appliance on or near hot surfaces, e.g. hobs. The power cord must not come into contact with hot parts or be pulled across sharp edges.

Never immerse the base unit in water or place it in the dishwasher. Do not steamclean the appliance. Do not use the appliance with damp hands.

23

enImportant safety information

After each use, whenever the appliance is unsupervised, prior to assembly, prior to disassembly, prior to cleaning and in the event of an error, the appliance must always be disconnected from the mains. W Risk of injury!

Before replacing accessories or additional parts which move during operation, the appliance must be switched off and dis connected from the power supply. After switching off, the drive continues for a short time. Wait until the drive has come to a standstill.

Do not adjust the swivel arm while the appliance is switched on. Only use tools when the bowl is inserted, the lid is fitted and the

protective drive covers are in place! When using accessories, fit the bowl, lid and drive covers according to the instructions!

While operating the appliance, never reach into the bowl or filling shaft with your hands. Do not insert any objects (e.g. wooden spoon) into the bowl or filling shaft. Keep hands, hair, clothing and other utensils away from rotating parts.

Never use tools and accessories or 2 accessories at the same time. When using the accessories, follow the individual operating instructions enclosed.

The accessory must be completely assembled before use. Never assemble the accessory on the base unit. The accessory should only be used in the intended operating position.

Do not grip the sharp blades or edges of the cutting discs. Take hold of cutting discs by the edge only.

Do not touch blender blades with bare hands. Never reach into the attached blender! Never use the blender

without the lid in place. Care shall be taken when handling the sharp cutting blades,

emptying the container and during cleaning. W Risk of scalding!

If processing hot liquids, steam escapes through the funnel in the lid.

W Risk of suffocation! Do not allow children to play with packaging material.

W Caution! We recommend that the appliance is never switched on for longer than is necessary to process the ingredients. Do not operate at noload.

W Important! It is essential to clean the appliance thoroughly after each use or after it has not been used for an extended period (X Cleaning and servicing see page 29).

24

en Important safety information

Overload protection If the motor switches itself off while the appliance is being used, the overload protection feature has been activated. A possible cause may be that too much food was processed at one time. If a safety system is activated, see Troubleshooting. The appliance requires no maintenance.

Overview Figure A: Base unit 1 Release button 2 Swivel arm

Easy Armlift function to support the upward movement of the arm (see Work positions).

3 Rotary switch When the appliance has been switched off (position 0/off), the appliance runs automatically to the optimum position for changing the tools. 0/off = Stop M = Instantaneous switching at maximum speed, hold switch for required blending duration. Settings 17, Operating speed: 1 = low speed slow, 7 = high speed fast.

4 Operating indicator Is lit while the appliance is operating (rotary switch on M or 17). Flashes if the appliance has been operated incorrectly, the electronic fuse has tripped or the appliance is defective see section Troubleshooting.

Congratulations on the purchase of your new Bosch appliance. You can find further information about our products on our website.

Contents Intended use .............................................22 Important safety information .....................22 Safety systems .........................................24 Overview...................................................24 Operating positions...................................25 Operation ..................................................26 Cleaning and servicing .............................29 Storage .....................................................30 Troubleshooting ........................................30 Application examples ...............................31 Special accessories ..................................32 Disposal ....................................................32 Guarantee.................................................32

W Explanation of the symbols on the appliance or accessory

i Follow the instructions in the operating instructions.

Y Caution! Rotating blades.

W Caution! Rotating tools. Do not place fingers in the feed tube.

Safety systems Start lock-out See Operating positions table. The appliance can be switched on in posi tion 1 and 3 only:

when the bowl (11) has been inserted and turned until it locks into place.

Restart lock-out If the power is interrupted, the appliance remains switched on but the motor does not start running again when the power is restored. To switch the appliance on again, turn the rotary switch to 0/off, then switch on.

25

enOperating positions

5 Drive cover To remove the drive cover, press on the rear area and remove cover.

6 Drive for continuousfeed shredder and citrus press (optional accessory*). When not in use, attach the drive cover.

7 Drive for tools (stirrer, whisk, kneading hook) and mincer (optional accessory*)

8 Blender drive cover 9 Drive for blender

(optional accessory*) When not in use, attach the blender drive cover.

10 Automatic cord winder Bowl with accessories 11 Stainless steel stirring bowl 12 Lid Tools 13 Professional flexi stirring whisk 14 Professional beating whisk 15 Kneading hook with dough deflector 16 Accessories bag

For storage of the tools and cutting discs.

Continuous-feed shredder 17 Pusher 18 Cover with filling shaft 19 Cutting discs

a Professional Supercut reversible disc coarse / fine

b Reversible shredding disc coarse / fine

c Fine grating disc d Reversible slicing / shredding disc*

20 Disc holder 21 Housing with outlet opening Blender* 22 Blender jug 23 Lid 24 Funnel * If an accessory is not included in the

product package, it can be purchased via the trade or customer service.

Operating positions Figure B: Attention: Before operating the appliance, attach the tool / accessory to the correct drive and in the correct position and place in the operating position according to this table. The swivel arm must be engaged in every operating position. Note: The swivel arm features an Easy Armlift function which supports the upwards movement of the swivel arm.

Selecting the operating position: Press the Release button and move the swivel arm. Support movement with your hand.

Move the swivel arm until it engages in the required position.

Position Drive Tool / Accessory

Operating speed

1 7

17

15

13

2 7 *

3 6 37

35

4

9 57

7 57

26

en Operation

* Insert / remove whisk, stirrer or kneading hook.

Operation W Risk of injury!

Do not insert mains plug until all preparations for working with the appliance are complete.

W Attention! Do not operate the appliance without an accessory / tool in the operating position. Do not operate the appliance empty. Do not expose appliance or accessories to heat sources. Parts are not microwavesafe.

Before operating the appliance and accessories for the first time, clean thoroughly; see Cleaning and servicing.

Preparation Place the base unit on a smooth, clean surface.

Pull out the cord in one go to the required length (max. 100 cm) and slowly release; the cord is locked (Figure C).

Reducing the cord length: Pull gently on the cord and allow it to roll up to the required length. Then gently pull the cord again and slowly release; the cable is locked.

Warning! Do not twist the cord when inserting it. If the appliance features an automatic cord winder, do not insert the cord manually. If the cord jams, pull out the cord all the way and then allow it to wind up.

Insert the mains plug.

Bowl and tools Observe the application examples in table L

W Risk of injury from rotating tools! While the appliance is operating, never place fingers in the mixing bowl. Attach the cover (12) before operating the appliance! Do not change tools until the drive has come to a standstill when the appliance is switched off, the drive continues running briefly and stops in the tool change position.

Do not move the swivel arm until the tool has come to a standstill. Always secure unused drives with protective drive covers. Attention! Use bowl with this appliance only. Professional flexi stirring whisk (13) for stiring mixtures, e.g. cake mixture, fruit cake, and folding in ingredients such as raisins and chocolate chips Professional beating whisk (14) for whisking egg whites and cream (min. 30 % fat content) and for mixing sponge mixture Kneading hook (15) for kneading dough e.g. yeast dough, bread dough, pizza dough, pasta dough, pastry and folding in ingre dients such as seeds into the dough Important information concerning the use of the whisk Figure D: The whisk should almost touch the bottom of the bowl to ensure that the ingredients are optimally mixed. If not, adjust the height of the whisk as follows:

Remove mains plug. Press the Release button and move the swivel arm to position 2.

Insert the whisk into the drive until the whisk locks into position.

Hold whisk in place and loosen nut clockwise using openended wrench (size 8).

Set the whisk to the optimum height by rotating the whisk: Turn clockwise: Raise Turn anticlockwise: Lower

Press the Release button and move the swivel arm to position 1.

Check the height of the whisk and, if required, correct.

27

enOperation

When the height has been set correctly, press Release button and move the swivel arm to position 2.

Hold whisk in place and tighten nut anticlockwise using openended wrench (size 8).

Working with the bowl and the tools Figure E:

Press the Release button and move the swivel arm to position 2.

Insert the bowl: Tilt the bowl forwards and then set it down. Turn anticlockwise until it locks into place.

Depending on the processing task, insert the stirrer, whisk or kneading hook until it locks into position.

Note: If using the kneading hook, rotate the dough deflector until the kneading hook can lock into position (Figure E-4b).

Put the ingredients to be processed into the bowl.

Press the Release button and move the swivel arm to position 1.

Attach the cover. Set the rotary switch to the desired setting.

Adding more ingredients Switch off the appliance with the rotary switch.

Add more ingredients through the feed tube in the cover.

or Remove lid. Press the Release button and move the swivel arm to position 2.

Add ingredients. After using the appliance

Switch off the appliance with the rotary switch.

Remove mains plug. Remove lid.

Press the Release button and move the swivel arm to position 2.

Take the tool out of the drive. Remove the bowl. Clean all parts, see Cleaning and servicing.

Continuous-feed shredder Observe the application examples in table M

W Risk of injury! Do not grip the sharp blades or edges of the cutting discs. Take hold of cutting discs by the edge only. Before attaching / removing the continuousfeed shredder, wait until the drive has come to a standstill and pull out the mains plug. Do not reach into the feed tube. Warning! The continuousfeed shredder must be completely assembled before use. Never assemble the continuousfeed shredder on the base unit. Operate the continuousfeed shredder in the indicated operating position only. Predetermined breaking point Figure F: The builtin predetermined breaking point protects the drive of the appliance. If an overload occurs, the drive shaft of the continuousfeed shredder breaks. However, the drive shaft can easily be replaced. A new disc holder with drive shaft is available from customer service. Professional Supercut reversible disc coarse / fine for cutting food into thick or thin slices, e.g. fruit and vegetables. Marking:

Grob = thick slices Fein = thin slices

Note: Not suitable for processing hard cheese, bread, rolls or chocolate. Tip: Only cut up cooked potatoes once they have cooled down.

28

en Operation

Reversible shredding disc coarse / fine for shredding food coarsely or finely, e.g. fruit, vegetables or cheese as Gouda or Edam. Marking:

2 = coarse side 4 = fine side

Note: Not suitable for processing nuts or hard cheese, e.g. Parmesan. Tip: Shred soft cheese with the coarse side only. Fine grating disc for shredding food finely, e.g. nuts or hard cheese such as Parmesan. Note: Not suitable for processing soft cheese and cheese slices. Reversible slicing / shredding disc for grating raw potatoes or cutting into slices. Note: Not suitable for processing very fibrous foods, e.g. leek or mango. Working with the continuous-feed shredder Figure G:

Press the Release button and move the swivel arm to position 2.

Insert the bowl: Tilt the bowl forwards and then set it down. Turn anticlockwise until it locks into place.

Press the Release button and move the swivel arm to position 3.

Remove drive cover from the drive of the continuousfeed shredder (Figure G-5a).

Hold disc holder at the lower end, ensuring that the two tips are face up.

Carefully place the required slicing or shredding disc onto the tips of the disc holder (Figure G-6a). In the case of reversible discs, ensure that the required side is face up.

Grip disc holder at the upper end and insert into the housing (Figure G-6b).

Attach the cover (note mark) and turn all the way in a clockwise direction.

Place continuousfeed shredder on the drive and rotate all the way in a clockwise direction, as illustrated in Figure G-8.

Turn rotary switch to recommended setting.

Put food to be processed in the feed tube and push down with the pusher. W Warning!

Prevent the cut ingredients from building up in the outlet opening. Tip: To ensure even cutting results, process thin ingredients in bunches. Note: If the food to be processed sticks in the continuousfeed shredder, switch food processor off, pull out mains plug, wait until the drive comes to a standstill, remove cover from the continuousfeed shredder and empty feed tube. After using the appliance

Switch off the appliance with the rotary switch.

Rotate the continuousfeed shredder in an anticlockwise direction and remove.

Rotate the lid in an anticlockwise direction and remove.

Remove disc holder with disc. To do this, press finger from below against the drive shaft (Figure H).

Clean parts.

Blender Observe the application examples in table N

W Risk of injury from sharp blades / rotating drive! Never place fingers in the attached blender! Do not remove / attach the blender until the drive is at a standstill! Operate the assembled blender only and with the lid attached. Do not operate blender when empty.

W Risk of scalding! If processing hot liquids, steam escapes through the funnel in the lid.

29

enCleaning and servicing

Working with the blender Figure J:

Press the release button and move the swivel arm to position 4.

Remove the blender drive cover. Attach blender jug (mark on the handle on mark on the base unit) and turn all the way in an anticlockwise direction.

Add ingredients. Maximum capacity liquid = 1.25 litres; maximum capacity frothing or hot liquids max. 0.75 litres.

Attach the cover and turn anticlockwise all the way into the blender handle. The cover must be locked in position.

Set the rotary switch to the desired setting.

Adding more ingredients Figure J-8:

Switch off the appliance with the rotary switch.

Remove the lid and add ingredients. or

remove the funnel and gradually add solid ingredients through the refill opening.

or pour liquid ingredients through the funnel.

After using the appliance Switch off the appliance with the rotary switch.

Rotate the blender in a clockwise direction and remove.

Tip: It is recommended to clean the blender immediately after use.

W Attention! Using unsuitable food may damage the appliance.

Do not process food that is hotter than 70 C in the blender jug.

Do not process frozen ingredients, apart from ice cubes, unless they have been added into a sufficient amount of liquid.

Do not process food that contains hard components. Before processing pip and stone fruits (apples, peaches, etc.), remove the pips or stones.

Notes Restrictions on processing:

Do not use it to chop ingredients like almonds, onions, parsley and meat.

The blender cannot produce spreads, such as peanut butter,coconut butter or nut spreads.

Use enough liquid when mixing solid food.

Mix powdered food with sufficient liquid before blending, or dissolve it entirely in liquid. Examples of powdered food include icing sugar, cocoa powder, roasted soybeans, flour, protein powder.

Cleaning and servicing The attachments and accessories used must be thoroughly cleaned after each use. X Table O Attention! Do not use abrasive cleaning agents. Sur faces may be damaged.

Cleaning the base unit W Risk of electric shock!

Never immerse the base unit in water or place under running water. Do not use a steam cleaner.

Remove mains plug. Wipe the base unit and drive cover with a damp cloth. If required, use a little detergent.

Then dry the base unit.

Cleaning the bowl and tools The bowl and tools are dishwasher proof. Do not wedge plastic parts in the dishwasher, as they could be permanently deformed during the washing process!

Cleaning the continuous-feed shredder

W Risk of injury from sharp blades! Do not grip the sharp blades or edges of the cutting discs. Clean them with a brush. All parts of the continuousfeed shredder are dishwasherproof.

30

en Storage

Tip: To remove the red film after processing e.g. carrots, pour a little cooking oil on a cloth and rub the film off the continuous feed shredder (not the cutting discs). Then rinse the continuousfeed shredder.

Cleaning the blender W Risk of injury from sharp blades!

Do not touch blender blades with bare hands. The blender jug, lid and funnel are dishwasherproof. Tip: After processing liquids, it is often suffi cient to clean the blender without removing it from the appliance. Pour 700 ml of water and a drop of washingup liquid into the attached blender. Switch on the blender for aproximately 1 minute (setting 7). Pour out the water and rinse out the blender with clear water. Important information If required, clean accessories bag. Follow care instructions in the bag.

Storage W Risk of injury!

When the appliance is not in use, pull out the mains plug. Figure K:

Store tools and cutting discs in the accessories bag.

Keep accessories bag in the bowl.

Troubleshooting W Risk of injury!

Before eliminating a fault, pull out the mains plug. Note: The Operating indicator flashes if the appliance has been operated incorrectly or the electronic fuse has tripped or the appliance is defective. The swivel arm must be engaged in every operating position.

Initially try to eliminate the problem which has occurred with the help of the following information. Troubleshooting Appliance does not start. Remedial action

Check the power supply. Check the mains plug. Check swivel arm. Correct position? Engaged?

Screw on blender or bowl as far as possible.

Attach the blender cover and screw on as far as possible.

Attach drive cover to unused drives. The safety lock is active. Switch appliance to 0/off and then back to the required setting.

Troubleshooting Appliance switches off during use. The overload protection feature has been activated. Too much food was processed at one time. Remedial action

Switch off the appliance. Reduce processing quantity.

Troubleshooting While the drive was running, the release button was inadvertently pressed. The swivel arm moves up. The drive switches off, but does not stop in the tool change position. Remedial action

Set the rotary switch to 0/off. Move swivel arm to position 1. Switch on appliance (setting 1). Switch off appliance again. Tool stops in tool change position.

Troubleshooting Blender does not start working or stops during use, the drive is humming. Blade is blocked. Remedial action

Switch off the appliance and pull out the mains plug.

Detach the blender and remove the obstruction.

31

enApplication examples

Reattach the blender. Switch on the appliance.

Important information If the fault cannot be eliminated, please contact customer service.

Application examples Observe general recommendations in table L, table M, table N. Do not exceed permitted maximum quantities.

Sponge mixture Basic recipe 2 eggs 23 tbs. hot water 100 g sugar 1 packet of vanilla sugar 70 g flour 70 g cornflour Baking powder if required Beat the ingredients (except flour and cornflour) with the whisk for approx. 46minutes at setting 7 until frothy.

Rotate switch to setting 1 and spoon in the sifted flour and cornflour within approx. to 1 minute.

Maximum quantity: 2 x basic recipe

Cake mixture 6 eggs 500 g sugar 1 pinch of salt 2 packets of vanilla sugar or peel from lemon

500 g butter or margarine (room temperature)

1000 g flour 1 packet of baking powder 250 ml milk Mix the eggs, sugar, salt and vanilla sugar or lemon peel with the stirrer for approx. 10 seconds at setting 1.

Set to setting 5 and process for approx. 120 seconds.

Add butter and process for approx. 60 seconds at setting 3.

Add flour and baking powder and process for approx. 2 minutes at setting 1.

Set to setting 3 and gradually add the milk within 2 minutes.

Maximum quantity: 1 x basic recipe

Heavy fruit cake Basic recipe 3 eggs 135 g sugar 135 g margarine 255 g flour 10 g baking powder 150 g currants 150 g mixed dried fruit Insert stirring whisk. Add all ingredients except the dried fruit. Process for 30 seconds at setting 1. Then process for 35 minutes at

setting 5. Select setting 2. Add the dried fruit within the next

3060 seconds. Maximum quantity: 2 x basic recipe

Short pastry Basic recipe 125 g butter (room temperature)

100125 g sugar 1 egg 1 pinch of salt A little lemon peel or vanilla sugar 250 g flour Baking powder if required Mix all ingredients with the stirrer for

approx. minute at setting 1, then for approx. 36 minutes at setting 3.

From 250 g flour: Knead the ingredients with the kneading hook for approx. minute at setting 1, then for approx. 56 minutes at setting 3.

Maximum quantity: 2 x basic recipe

Yeast dough Basic recipe 500 g flour 1 egg 80 g fat (room temperature)

32

en Special accessories

80 g sugar 200250 ml lukewarm milk 25 g fresh yeast or 1 packet of dried yeast

Peel of lemon 1 pinch of salt Mix all ingredients with the kneading hook for approx. minute at setting 1, then for approx. 36 minutes at setting 3.

Maximum quantity: 2 x basic recipe

Pasta dough Basic recipe 300 g flour 3 eggs 12 tbs. (1020 g) cold water as required Process all ingredients for approx. 35 minutes at setting 3 until a dough forms.

Maximum quantity: 1.5 x basic recipe

Bread dough Basic recipe 1000 g flour 2 packets of dry yeast 2 tsp. salt 600650 ml warm water Mix all ingredients with the kneading hook for approx. minute at setting 1, then for approx. 67 minutes at setting 3.

Mayonnaise 1 egg 1 tsp. mustard l oil 1 tbs. lemon juice or vinegar 1 pinch of salt 1 pinch of sugar

Ingredients must be at room temperature. Making mayonnaise is only possible with whole egg.

Process the ingredients (except the oil) in the blender for several seconds at setting 3or4.

Switch the blender to setting 7 and slowly pour the oil through the funnel and mix until the mayonnaise emulsifies.

Eat the mayonnaise immediately, do not store.

Special accessories You can buy accessories from the after sales service, from specialist retailers or online. Only use genuine accessories as these have been specifically designed for your appliance. Accessories vary from one appliance to another. When purchasing accessories, always quote the exact product number (ENr.) of your appliance. You can find out which accessories are available for your appliance in our cata logue, in the online shop or from our after sales service. www.bosch-home.com

Disposal

J Dispose of packaging in an environ mentallyfriendly manner. This appliance is labelled in accordance with European Directive 2012/19/EU concerning used electrical and electronic appliances (waste electrical and electronic equipment WEEE). The guideline determines the frame work for the return and recycling of used appliances as applicable throughout the EU. Please ask your specialist retailer about current disposal facilities.

Guarantee The guarantee conditions for this appliance are as defined by our representative in the country in which it is sold. Details regarding these conditions can be obtained from the dealer from whom the appliance was purchased. The bill of sale or receipt must be produced when making any claim under the terms of this guarantee.

Changes reserved.

33

frConformit dutilisation

Conformit dutilisation Cet appareil est destin exclusivement une utilisation domestique et non professionnelle. Utiliser cet appareil uniquement pour des quantits de prparations culinaires courantes et pour des dures de service normales. Cet appareil convient pour mlanger, ptrir et fouetter des produits alimentaires. Lappareil ne doit pas servir transformer dautres substances ou objets. Dautres applications sont possibles condition dutiliser dautres accessoires homologus par le fabricant. Utiliser lappareil uniquement avec des pices et accessoires dorigine homologus. Ne jamais utiliser les accessoires destins dautres appareils. Nutiliser lappareil que dans des pices intrieures temprature ambiante et jusqu 2 000 m audessus du niveau de la mer.

Consignes de scurit importantes Lire attentivement cette notice dutilisation. Respecter les instructions quelle contient et la ranger soigneusement ! Si lappareil change de propritaire, lui remettre cette notice. Le nonrespect des instructions permettant dutiliser correctement lappareil dgage le fabricant de toute responsabilit envers les dommages qui pourraient en rsulter. Cet appareil peut tre utilis par des personnes aux capacits physiques, sensorielles ou mentales rduites ou des personnes inexprimentes, condition quelles soient surveilles ou quelles aient t informes de lutilisation sre de lappareil et quelles comprennent les risques inhrents son usage. Il faut tenir les enfants lcart de lappareil et du cordon de branchement et ne pas leur permettre dutiliser lappareil. Ne pas laisser les enfants jouer avec lappareil. Le nettoyage et lentretien incombant lutilisateur ne doivent pas tre effectus par des enfants.

W Risque de chocs lectriques et dincendie ! Ne brancher et nutiliser lappareil que conformment aux indica

tions figurant sur la plaque signaltique. Nutiliser lappareil que si son cordon dalimentation et lappareil luimme ne prsentent aucun dommage. Afin dcarter tout danger, seul notre service aprsvente est habilit rparer lappareil, comme par exemple procder au remplacement dun cordon dalimentation endommag.

Allumez et teignez lappareil uniquement par linterrupteur rotatif. Ne jamais raccorder lappareil des minuteries ou des prises

pouvant tre commandes distance. Surveiller toujours lappareil pendant son fonctionnement !

34

fr Consignes de scurit importantes

Ne jamais poser lappareil sur des surfaces chaudes (tables de cuisson p. ex.) ou proximit de cellesci. Ne pas mettre le cordon dalimentation en contact avec des lments brlants et ne pas le faire glisser sur des artes vives.

Ne jamais plonger lappareil de base dans leau ou le mettre dans un lavevaisselle. Ne jamais utiliser de nettoyeur vapeur. Ne pas utiliser lappareil avec les mains humides.

Lappareil doit toujours tre dbranch du secteur, aprs chaque utilisation, lorsquil nest pas sous surveillance, lorsquil doit tre mont ou dmont, avant de le nettoyer et en cas de panne. W Risques de blessures !

Lappareil doit tre teint et dbranch du secteur avant de procder au changement daccessoires ou de pices complmentaires mobiles en fonctionnement. Aprs extinction de lappareil, son moteur continue de tourner brivement. Attendre larrt complet de lentranement.

Ne pas dplacer le bras pivotant lorsque lappareil est allum. Exploiter les ustensiles uniquement lorsque le bol, son couvercle

ainsi que les couvercles de protection des entranements sont mis en place ! Lors de lutilisation dustensiles, monter le bol, son couvercle et les couvercles de protection des entranements conformment la notice !

Pendant le fonctionnement, ne jamais introduire les mains dans le bol ni dans louverture pour ajout. Ne pas introduire dobjet (p. ex. cuillre en bois) dans le bol ni dans louverture pour ajout. Tenir les mains, les cheveux, les vtements et autres ustensiles distance des pices en rotation.

Ne jamais utiliser simultanment des ustensiles et accessoires ni 2 accessoires. Lors de lutilisation des accessoires, respecter aussi bien la prsente notice que les notices dutilisation jointes.

Utiliser uniquement laccessoire ltat entirement assembl. Ne jamais assembler les accessoires sur lappareil de base. Utiliser uniquement laccessoire dans la position de travail prvue.

Napprochez pas les doigts des lames et des artes, tranchantes, des disques rduire. Ne saisissez les disques rduire que par leurs bords !

Ne touchez pas les lames du mixeur avec les mains nues. Ne jamais introduire les doigts dans le mixeur en place !

Ne jamais exploiter lappareil sans couvercle. Attention quand vous manipulez les lames acres lors du vidage

du rcipient ou de son nettoyage.

35

frConsignes de scurit importantes

W Risque de brlures ! Lorsque vous traitez des aliments mlangs trs chauds, de la vapeur traverse lentonnoir mnag dans le couvercle.

W Risque dasphyxie ! Ne jamais laisser les enfants jouer avec les emballages.

W Attention ! Ne jamais laisser lappareil allum plus longtemps que ncessaire au traitement des produits alimentaires. Ne pas faire tourner lappareil vide.

W Important ! Nettoyer soigneusement lappareil aprs chaque utilisation ou aprs une longue dure sans utilisation (X Nettoyage et entretien voir page 42).

W Explication des symboles sur lappareil et les accessoires

i Respectez les instructions figurant dans la notice dutilisation.

Y Prudence ! Lames rotatives.

W Prudence ! Accessoires rotatifs. Nintroduisez pas les doigts dans lorifice dajout.

Vous venez dacheter ce nouvel appareil Bosch et nous vous en flicitons cordialement. Sur notre site web, vous trouverez plus informations sur nos produits.

Sommaire Conformit dutilisation .............................33 Consignes de scurit importantes ..........33 Systmes de scurit ...............................35 Vue densemble ........................................36 Positions de travail ...................................37 Utilisation ..................................................37 Nettoyage et entretien ..............................42 Rangement ...............................................42 Aide en cas de drangement....................42 Exemples dutilisation ..............................43 Accessoires en option ..............................45 Mise au rebut ............................................45 Garantie ....................................................45

Systmes de scurit Scurit anti-enclenchement Voir le tableau Positions de travail . Lappareil se met en marche sur les positions 1 et 3 uniquement :

si vous avez mis le bol (11) en place et lavez fait tourner jusqu ce quil encrante.

Scurit anti-renclenchement En cas de coupure de courant, lappareil reste en position allume mais le moteur ne redmarre pas une fois le courant revenu. Pour rallumer, tournez linterrupteur rotatif sur P puis ramenezle en position allume.

36

fr Vue densemble

Scurit anti-surcharge Si le moteur steint tout seul pendant lutilisation, ceci signifie que la protection antisurcharge sest active. Lune des causes possibles : trop grande quantit daliments traite en mme temps. Pour savoir comment procder si le systme de scurit sactive, voir Aide en cas de drangement . Lappareil ne ncessite aucun entretien.

Vue densemble Figure A : Appareil de base 1 Touche de dverrouillage 2 Bras pivotant

Fonction Easy Armlift pour assister le mouvement montant du bras (voir Positions de travail ).

3 Interrupteur rotatif Aprs lextinction (position P), lappareil se rend automatiquement sur la position optimale pour changer les accessoires. P = Arrt M = Touche pulse, avec vitesse la plus leve, maintenez linterrupteur pendant la dure de fonctionnement souhaite. Vitesse 1-7, vitesse de travail : 1 = vitesse basse marche lente, 7 = vitesse leve marche rapide.

4 Voyant de fonctionnement Il reste allum pendant la marche (interrupteur rotatif sur M ou 1-7). Il clignote en cas derreurs pendant lutilisation de lappareil, si le fusible lectronique disjoncte ou en prsence dun dfaut dans lappareil, voir le chapitre Aide en cas de drangement .

5 Couvercle protgeant le mcanisme dentranement Pour retirer le couvercle protgeant lentranement, appuyez sur la zone arrire puis retirez le couvercle.

6 Entranement pour accessoire rpeur / minceur et presse-agrumes (accessoire en option*). Lorsque vous nutilisez pas lentrane ment, protgezle avec son couvercle.

7 Entranement pour les accessoires (fouet mlangeur, fouet batteur, crochet ptrisseur) et hachoir viande (accessoire en option*)

8 Couvercle protgeant lentranement du mixeur

9 Entranement du bol mixeur (accessoire en option*) Lorsque vous nutilisez pas lentrane ment, protgezle avec son couvercle.

10 Enrouleur automatique de cordon Bol mlangeur avec accessoires 11 Bol mlangeur en acier inoxydable 12 Couvercle Accessoires 13 Fouet mixeur Profi Flexi 14 Fouet batteur Profi 15 Crochet ptrisseur avec dflecteur

de pte 16 Sacoche daccessoires

Pour ranger les accessoires et les disques rduire.

Accessoire rpeur / minceur 17 Pilon-poussoir 18 Couvercle avec ouverture pour ajout 19 Disques rduire

a Disque rversible Profi Supercut pais / fin

b Disque rversible rper grossier / fin

c Disque rper fin d Disque rversible mincer / rper*

20 Porte-disque 21 Botier avec orifice de sortie Mixeur* 22 Bol mixeur 23 Couvercle 24 Entonnoir * Si un accessoire na pas t livr dorigine, vous pouvez vous le procurer dans le commerce et auprs du service aprsvente.

37

frPositions de travail

Positions de travail Figure B : Attention ! Ne faites fonctionner lappareil que si les accessoires se trouvent sur lentranement correct, sur la position correcte et en posi tion de travail. Le bras pivotant doit encran ter dans chaque position de travail. Remarque Le bras pivotant est dot de la fonction Easy Armlift qui assiste le mouvement montant du bras pivotant.

Rglage de la position de travail : Appuyez sur la touche de dverrouillage

puis faites tourner le bras pivotant. Aidez le mouvement dune main.

Amenez le bras pivotant sur la position voulue jusqu ce quil encrante.

Position Entranement Outils / Acces- soires

Vitesse de travail

1 7

17

15

13

2 7 *

3 6 37

35

Position Entranement Outils / Acces- soires

Vitesse de travail

4

9 57

7 57

* Mise en place / retrait du fouet batteur, fouet mixeur et crochet ptrir.

Utilisation W Risque de blessure !

Ne branchez la fiche mle dans la prise de courant quune fois tous les prparatifs sur lappareil achevs. Attention ! Ne faites fonctionner lappareil quavec les accessoires / outils en position de travail. Ne faites pas fonctionner lappareil vide. Nexposez pas lappareil et ses accessoires des sources de chaleur. Les pices ne vont pas au four microondes.

Avant de les utiliser pour la premire fois, nettoyez soigneusement lappareil et ses accessoires, voir le chapitre intitul Nettoyage et entretien .

Prparatifs Posez lappareil de base sur une

surface lisse et propre. Tirez continuellement le cordon jusqu

sortir la longueur voulue (1,00 mtre maxi.) puis relchezle lentement. Le cordon simmobilise sur la longueur voulue. (figure C).

Pour rduire la longueur du cordon : Tirez lgrement sur le cordon, puis laissezen la longueur voulue senrouler. Ensuite, tirez nouveau lgrement sur le cordon, puis relchezle lentement. Le cordon simmobilise sur la longueur voulue.

38

fr Utilisation

Attention ! Si le cordon se coince en route, sortezen la longueur maximum puis laissezle nouveau senrouler.

Introduisez la fiche dans la prise de courant.

Bol et accessoires Tenez compte des exemples dutilisation donns dans le tableau. L

W Risque de blessure avec les pices en rotation ! Pendant le fonctionnement, nintroduisez jamais les doigts dans le bol mlangeur. Utilisezle uniquement avec le couvercle (12) en place ! Changez les accessoires uniquement lorsque lappareil est au repos une fois lappareil teint, le mcanisme dentranement continue de tourner un certain temps puis simmobilise sur la position de changement des accessoires. Tournez le bras pivotant seulement aprs que lappareil sest immobilis. Toujours recouvrir les entranements qui ne servent pas avec des couvercles de protection. Attention ! Utilisez le bol uniquement en fonctionnement sur cet appareil. Fouet mixeur Profi Flexi (13) pour ptrir de la pte, par exemple de la pte gteau, de la tarte aux fruits, etc. et pour incorporer des ingrdients comme des raisons secs et des clats de chocolat Fouet batteur Profi (14) pour monter des ufs en neige, battre de la crme (au moins 30 % de matire grasse) et pour mlan ger de la pte gnoise Crochet ptrisseur (15) pour ptrir de la pte, par exemple de la pte leve, de la pte pain, de la pte pizza, de la pte nouilles, de la pte viennoiserie et pour incorporer des ingrdients comme des graines dans la pte

Information importante sur lutilisation du fouet batteur (Figure D): Le fouet batteur devrait presque toucher le fond du bol afin que les ingrdients soient parfaitement mlangs. Si a nest pas le cas, rglez la hauteur du fouet batteur de la manire suivante :

Dbranchez la fiche mle de la prise de courant.

Appuyez sur la touche de dverrouillage et amenez le bras pivotant sur la position 2.

Enfoncez le fouet batteur jusqu ce quil encrante dans lentranement.

Retenez le fouet batteur et desserrez lcrou avec la cl fourche (calibre 8) en tournant dans le sens des aiguilles dune montre.

Rglez la hauteur du fouet batteur en tournant ce dernier jusqu parvenir sur une hauteur optimale. Tournez dans le sens des aiguilles dune montre : Soulever Tournez dans le sens inverse des aiguilles dune montre : Abaisser

Appuyez sur la touche de dverrouillage et amenez le bras pivotant sur la position 1.

Vrifiez la hauteur du fouet batteur et corrigezla si ncessaire.

Une fois la hauteur correcte ment rgle, appuyez sur la touche de dverrouillage et amenez le bras pivotant sur la position 2.

Retenez le fouet batteur et serrez lcrou avec la cls fourche (calibre 8) en tournant en sens inverse des aiguilles dune montre.

Travailler avec le bol et les outils Figure E :

Appuyez sur la touche de dverrouillage et amenez le bras pivotant sur la position 2.

39

frUtilisation

Mise en place du bol : Prsentez le bol inclin vers lavant puis posezle. Tournez en sens inverse des aiguilles dune montre jusqu lencrantement.

Suivant besoins, enfoncez le fouet mlangeur, le fouet batteur ou le crochet ptrisseur jusqu ce quil encrante dans lentranement.

Remarque : Si vous choisissez le crochet ptrisseur tournez le dflecteur de pte jusqu ce que le crochet encrante (figure E-4b).

Versez les ingrdients prparer dans le bol.

Appuyez sur la touche de dverrouillage et amenez le bras pivotant sur la position 1.

Mettez le couvercle en place. Rglez linterrupteur rotatif sur la vitesse

voulue. Rajouter des ingrdients

teignez lappareil par linterrupteur rotatif.

Rajoutez les ingrdients par louverture pour ajout mnage dans le couvercle.

ou Enlevez le couvercle. Appuyez sur la touche de

dverrouillage et amenez le bras pivotant sur la position 2.

Ajoutez des ingrdients. Aprs le travail

teignez lappareil par linterrupteur rotatif.

Dbranchez la fiche mle de la prise de courant.

Enlevez le couvercle. Appuyez sur la touche de

dverrouillage et amenez le bras pivotant sur la position 2.

Dtachez laccessoire de lentranement.

Retirez le bol. Nettoyez toutes les pices, voir

Nettoyage et entretien .

Accessoire rpeur / minceur Tenez compte des exemples dutilisation donns dans le tableau. M

W Risque de blessure ! Napprochez pas les doigts des lames et des artes, tranchantes, des disques rduire. Ne saisissez les disques rduire que par leurs bords ! Ne posez/retirez laccessoire rpeur / minceur quaprs avoir teint le moteur et dbranch la fiche mle de la prise de courant. Nintroduisez pas les doigts dans louverture dajout. Attention ! Nutilisez laccessoire rpeur / minceur quentirement assembl. Nassemblez jamais laccessoire rpeur / minceur sur lappareil de base. Nutilisez laccessoire rpeur / minceur que dans la position de service indique. Protection contre la surcharge Figure F : Pour empcher un endommagement impor tant de votre appareil en cas de surcharge de laccessoire rpeur / minceur, larbre dentranement de ce dernier comporte une entaille (zone de rupture programme). En cas de surcharge, larbre dentranement casse cet endroit. Un nouveau porte disques arbre dentranement est dispo nible auprs du service aprsvente. Disque rversible Profi Supercut pais / fin pour mincer des aliments en tranches paisses ou fines, par exemple des fruits et des lgumes. Marquage :

Grob = tranches paisses Fein = tranches fines

Remarque : Ne convient pas pour le fromage pte dure, le pain, les petits pains ou le chocolat. Conseil : Ne coupez les pommes de terre cuites quune fois quelles ont refroidi.

40

fr Utilisation

Disque rversible rper grossier / fin pour rper des aliments en morceaux gros ou fins, par exemple des fruits, des lgumes ou du fromage comme le gouda ou ldam. Marquage :

2 = ct grossier 4 = ct fin

Remarque : Ne convient pas pour les noix ou les fromages pte dure, par exemple le parmesan. Conseil : Rpez le fromage pte molle avec le ct grossier. Disque rper fin pour rper finement des aliments, par exemple des noix ou du fromage pte dure comme le parmesan Remarque : Ne convient pas pour le fromage pte molle et le fromage en tranches. Disque rversible mincer / rper pour rper des pommes de terre crues ou les couper en tranches. Remarque : Ne convient pas pour les ali ments trs fibreux, par exemple le poireau ou la mangue. Travailler avec laccessoire rpeur / minceur Figure G :

Appuyez sur la touche de dverrouillage et amenez le bras pivotant sur la position 2.

Mise en place du bol : Prsentez le bol inclin vers lavant puis posezle. Tournez en sens inverse des aiguilles dune montre jusqu lencrantement.

Appuyez sur la touche de dverrouillage et amenez le bras pivotant sur la position 3.

Retirez le couvercle dentrane ment de laccessoire rpeur/minceur (figure G-5a).

Retenez lextrmit infrieure du portedisque ; il faut ce faisant que les deux pointes regardent vers le haut.

Posez prudemment le disque dcou per ou le disque rper sur les pointes du portedisques (figure G-6a). Avec les disques rversibles, veillez bien ce que le ct souhait regarde vers le haut.

Saisissez lextrmit suprieure du portedisques et introduisezla dans le botier (figure G-6b).

Posez le couvercle (respectez le repre) puis tournez dans le sens des aiguilles dune montre jusqu la bute.

Posez laccessoire rpeur / minceur sur lentranement comme sur la figure G-8, puis tournezle dans le sens des aiguilles dune montre jusqu la bute.

Rglez le interrupteur rotatif la vitesse recommande.

Versez les produits alimentaires traiter dans louverture dajout et faitesles avancer avec le pilon poussoir.

Attention ! vitez que les aliments coups ne saccumulent directement la sortie. Conseil : pour que la coupe des aliments soit rgulire, prsentez les aliments minces en bottes. Remarque : Si les aliments traiter devaient se coincer dans laccessoire rpeur / minceur, teignez le robot culinaire, dbranchez la fiche mle de la prise de courant et attendez que lentranement se soit immobilis, retirez le couvercle de laccessoire rpeur/minceur puis videz louverture dajout. Aprs le travail

teignez lappareil par linterrupteur rotatif.

Tournez laccessoire rpeur / minceur en sens inverse des aiguilles dune montre puis retirezle.

Tournez le couvercle en sens inverse des aiguilles dune montre puis retirezle.

41

frUtilisation

Retirez le portedisques avec le disque. Pour ce faire, appuyez avec le doigt, par le bas, contre larbre dentranement (figure H).

Nettoyez les pices.

Mixeur Tenez compte des exemples dutilisation donns dans le tableau. N

W Risque de blessures avec les lames tranchantes / lentranement en rotation ! Nintroduisez jamais les doigts dans le mixeur en place ! Ne retirez / posez le mixeur quaprs avoir arrt lentranement ! Nutilisez le mixeur quune fois assembl et avec son couvercle en place. Ne pas faire fonctionner le mixeur vide.

W Risque de brlure ! Lorsque vous traitez des aliments mlangs trs chauds, de la vapeur traverse lenton noir mnag dans le couvercle. Utilisation du mixeur Figure J :

Appuyez sur le bouton de dverrouillage et amenez le bras pivotant sur la position 4.

Retirez le couvercle protgeant lentranement du mixeur.

Mettez le bol mixeur en place (le repre sur la poigne et celui sur lappareil de base doivent concider) puis tournez en sens inverse des aiguilles dune montre jusqu la bute.

Ajoutez des ingrdients. Quantit maximale de liquide = 1,25 litre ; quantit maximale de liquides mous sants ou trs chauds = 0,75 litre.

Posez le couvercle et tournezle en sens inverse des aiguilles dune montre jusqu la bute dans la poigne du mixeur. Le couvercle doit avoir encrant.

Rglez linterrupteur rotatif la vitesse dsire.

Rajouter des ingrdients Figure J-8 :

teignez lappareil par linterrupteur rotatif.

Retirez le couvercle et ajoutez les ingrdients

ou retirez lentonnoir et rajoutez progres

sivement les ingrdients fermes par louverture

ou versez les ingrdients liquides par

lentonnoir. Aprs le travail

teignez lappareil par linterrupteur rotatif.

Tournez le mixeur dans le sens des aiguilles dune montre puis retirezle.

Conseil : il est prfrable de nettoyer le mixeur immdiatement aprs utilisation.

W Attention ! Des aliments non appropris peuvent endommager lappareil.

Ne pas traiter daliments chauds plus de 70 C dans le bol mixeur.

Ne pas traiter daliments surgels, sauf des glaons sils sont placs dans une quantit de liquide suffisante.

Ne pas traiter daliments qui comportent des constituants durs. Avant de traiter des fruits ppins et noyaux (pommes, pches, etc.), enlever les ppins et noyaux.

Remarques Restrictions dutilisation :

Ne pas broyer dingrdients tels que des amandes, des oignons, du persil et de la viande.

Le mixeur ne peut pas raliser de ptes tartiner telles que du beurre de caca hutes, du beurre de noix de coco ou de la compote de noix.

Mlanger les aliments durs avec suffi samment de liquide.

Avant de les mixer, mlanger les ali ments en poudre avec suffisamment de liquide ou les dissoudre compltement dans du liquide. Les aliments en poudre sont, par exemple, le sucre glace, le cacao en poudre, les fves de soja torrfies, la farine, le blanc doeuf en poudre.

42

fr Nettoyage et entretien

Nettoyage et entretien Les accessoires utiliss doivent tre soigneusement nettoys aprs chaque utilisation. X Tableau O Attention ! Nutilisez pas de dtergent abrasif. Vous risquez dendommager les surfaces.

Nettoyage de lappareil de base W Risque de chocs lectriques !

Ne plongez jamais lappareil de base dans leau et ne le tenez jamais sous leau du robinet ! Ne le nettoyez jamais avec un nettoyeur vapeur.

Dbranchez la fiche mle de la prise de courant.

Essuyez lappareil de base et les couvercles de protection du mcanisme dentranement avec un chiffon humide. Si ncessaire, ajoutez un peu de produit vaisselle.

Ensuite, essuyez lappareil avec un essuietout sec.

Nettoyage du bol mlangeur et des accessoires Le bol mlangeur et les accessoires peuvent aller au lavevaisselle. Ne coincez pas les pices en matire plastique dans le lavevaisselle car elles risqueraient de se dformer de faon irrversible pendant le lavage !

Nettoyer laccessoire rpeur / minceur

W Risque de blessures avec les lames tranchantes !

Napprochez pas les doigts des lames et des artes, tranchantes, des disques rduire. Pour les nettoyer, utilisez une brosse. Toutes les pices de laccessoire rpeur / minceur vont au lavevaisselle.

Conseil : Pour enlever le dpt rouge laiss aprs le traitement des carottes par exemple, versez un peu dhuile alimentaire sur un chiffon et frottez laccessoire rpeur / minceur avec (pas les disques rduire). Ensuite, rincez laccessoire rpeur / minceur.

Nettoyer le mixeur W Risque de blessures avec les lames

tranchantes ! Ne touchez pas les lames du mixeur avec les mains nues. Le bol mixeur, le couvercle et lentonnoir vont au lavevaisselle. Conseil : Aprs le traitement de liquides, il suffit souvent de nettoyer le mixeur sans le dtacher de lappareil. Pour cela, versez 700 ml deau additionne dune goutte de dtergent dans le mixeur en place. Faites fonctionner le mixeur pendant env. 1 minute (position 7). Jetez leau de nettoyage puis rincez le mixeur leau claire. Remarque importante Nettoyez la sacoche daccessoires suivant besoin. Respectez les consignes dentretien mentionnes dans la sacoche.

Rangement W Risque de blessure !

Si lappareil ne sert pas, dbranchez sa fiche mle de la prise de courant. Figure K :

Rangez les accessoires et les disques rduire dans la sacoche daccessoires.

Rangez la sacoche daccessoires dans le bol.

Aide en cas de drangement W Risque de blessure !

Avant de supprimer tout drangement, dbranchez la fiche mle de la prise courant.

43

frExemples dutilisation

Remarque importante Si une erreur a t commise dans le maniement de lappareil, si les fusibles lectroniques disjonctent ou en prsence dun dfaut dans lappareil, le voyant de fonctionnement se met clignoter. Le bras pivotant doit encranter dans chaque position de travail. Commencez par supprimer le problme laide des consignes qui suivent. Drangement Lappareil ne dmarre pas. Solution

Vrifiez lalimentation lectrique. Vrifiez la fiche mle. Contrlez le bras pivotant. Position

correcte ? Encrant ? Faites tourner le mixeur ou le bol

jusqu la bute. Mettez le couvercle en place et faitesle

tourner jusqu la bute. Posez les couvercles de protection sur

les entranements non utiliss. La scurit antirenclenchement est

active. Amenez lappareil sur la position P et puis ramenezle la vitesse dsire.

Drangement Lappareil steint pendant son utilisation. La protection antisurcharge est active. Trop grande quantit de produits alimen taires traite en mme temps. Solution

teignez lappareil. Rduisez la quantit traiter.

Drangement La touche de dverrouillage a t actionne par mgarde pendant que le mcanisme dentranement tournait. Le bras pivotant se dplace vers le haut. Le mcanisme dentranement steint mais ne demeure pas dans la position de changement doutil. Solution

Amenez linterrupteur rotatif sur la position P.

Amenez le bras pivotant sur la position 1.

Allumez lappareil (vitesse 1). teignez nouveau lappareil.

Lappareil simmobilise en position de changement daccessoire. Drangement Le mixeur ne dmarre pas ou sarrte pendant lutilisation. Le moteur bourdonne . Les lames sont bloques. Solution

teignez lappareil et dbranchez la fiche mle de la prise de courant.

Enlevez le mixeur et retirez lobstacle. Remettez le mixeur en place. Allumez lappareil.

Remarque importante Si vous narrivez pas rsoudre le drangement, veuillez s.v.p. vous adresser notre service aprsvente.

Exemples dutilisation Respectez les recommandations gnrales donnes dans les tableaux L, M et N. Ne dpassez pas les quantits maximales.

Pte biscuits Recette de base 2 oeufs 23 cuillres soupe deau trs

chaude 100 g de sucre 1 sachet de sucre vanill 70 g de farine 70 g de fcule ventuellement de la levure chimique Battez les ingrdients (sauf la farine

et la fcule) env. 4 6 minutes avec le fouet batteur la vitesse 7, jusqu ce que vous obteniez une mousse ferme.

Rglez linterrupteur rotatif la vitesse 1 et, en 1 minute environ, incorporez par cuilleres la farine et la fcule que vous aurez pralablement passes au tamis.

Quantit maximale : 2 fois la recette de base

44

fr Exemples dutilisation

Pte cake Recette de base 6 ufs 500 g de sucre 1 pince de sel 2 sachets de sucre vanill ou

le zeste d citron 500 g de beurre ou de margarine

( la temprature ambiante) 1000 g de farine 1 sachet de levure chimique 250 ml de lait Travailler les ufs, le sucre, le sel et le

sucre vanill ou le zeste de citron avec le fouet pendant env. 10 secondes la vitesse 1.

Rgler la vitesse 5 et travailler la pte pendant env. 120 secondes.

Incorporer le beurre et travailler la pte pendant env. 60 secondes la vitesse 3.

Ajouter la farine et la levure chimique et travailler la pte durant env. 2 minutes la vitesse 1.

Rgler la vitesse 3 et verser le lait peu peu dans les 2 minutes qui suivent.

Quantit maximale : 1 x la recette de base

Gteau aux fruits secs Recette de base 3 ufs 135 g de sucre 135 g de margarine 255 g de farine 10 g de levure chimique 150 g de raisins de Corinthe 150 g de mlange de fruits secs Mettez en place le fouet mixeur. Versez tous les ingrdients lexception

des fruits secs. Travaillez pendant 30 secondes sur la

position 1. Continuez ensuite pendant 3

5 minutes sur la position 5. Rglez sur la position 2. Ajoutez les fruits secs en lespace de 30

60 secondes. Quantit maximale : 2 x la recette de base

Pte brise Recette de base 125 g de beurre ( la

temprature ambiante) 100 125 g de sucre 1 oeuf 1 pince de sel un peu de zeste de citron ou du

sucre vanill 250 g de farine ventuellement de la levure chimique Travaillez tous les ingrdients pendant

env. minute sur la position 1, puis pendant env. 3 6 minutes sur la posi tion 3 avec le fouet mixeur.

partir de 250 g de farine : Ptrissez les ingrdients avec le crochet

ptrisseur pendant env. minute la vitesse 1, puis env. 5 6 minutes la vitesse 3.

Quantit maximale : 2 fois la recette de base

Pte la levure de boulanger Recette de base 500 g de farine 1 oeuf 80 g de matire grasse

( la temprature ambiante) 80 g de sucre 200 250 ml de lait tide 25 g de levure de boulanger frache ou

1 sachet de levure. Le zeste dun demicitron 1 pince de sel Travaillez tous les ingrdients environ

minute la vitesse 1, puis environ 36 minutes la vitesse 3 avec le crochet ptrisseur.

Quantit maximale : 2 fois la recette de base

45

frAccessoires en option

Pte ptes Recette de base 300 g de farine 3 oeufs 1 2 cuillres soupe (10 20 g) deau

froide, selon le besoin Travaillez tous les ingrdients pendant

3 5 minutes environ la vitesse 3 jusqu obtention dune pte.

Quantit maximale : 1,5 fois la recette de base

Pte pain Recette de base 1000 g de farine 2 sachet de levure 2 c. caf de sel 600650 ml deau chaude Travaillez tous les ingrdients environ

minute la vitesse 1, puis environ 67 minutes la vitesse 3 avec le crochet ptrisseur.

Mayonnaise 1 uf 1 c. caf de moutarde l dhuile 1 c. s. de jus de citron ou de vinaigre 1 pince de sel 1 pince de sucre

Les ingrdients doivent tre la tempra ture ambiante. La mayonnaise ne peut tre prpare quavec des ufs entiers.

Pendant quelques secondes, mlangez tous ces ingrdients (sauf lhuile) avec le mixeur rgl la vitesse 3 ou 4.

Rglez ensuite le mixeur la vitesse 7, versez lhuile lentement par lentonnoir puis travaillez le mlange jusqu ce que la mayonnaise soit bien ferme.

La mayonnaise ne se conserve pas long- temps, consommez-la rapidement.

Accessoires en option Accessoires en optionVous pouvez acheter les accessoires auprs de notre service aprsvente, de revendeurs spcialiss ou sur Internet. Utilisez uniquement les acces soires dorigine, car ils sont parfaitement adapts votre appareil. Les accessoires sont spcifiques lappareil. Lors de lachat, indiquez toujours la dsignation exacte de votre appareil (ENr.). Pour connatre les accessoires disponibles pour votre appareil, consultez notre cata logue, notre boutique en ligne ou le service aprsvente. www.bosch-home.com

Mise au rebut

J Eliminez lemballage en respectant lenvironnement. Cet appareil est marqu selon la directive europenne 2012/19/UE relative aux appareils lectriques et lectroniques usags (waste electrical and electronic equip- ment WEEE). La directive dfinit le cadre pour une reprise et une rcupration des appareils usags applicables dans les pays de la CE. Sinformer auprs du revendeur sur la procdure actuelle de recyclage.

Garantie Les conditions de garantie applicables sont celles publies par notre distributeur dans le pays o a t effectu lachat. Le revendeur chez qui vous vous tes procur lappareil fournira les modalits de garantie sur simple demande de votre part. En cas de recours en garantie, veuillez toujours vous munir de la preuve dachat.

Sous rserve de modifications.

46

it Uso corretto

Uso corretto Questo apparecchio pensato esclusivamente per lutilizzo in abitazioni private e in ambito domestico. Utilizzare lapparecchio solo per quantit e tempi di preparazione usuali nellattivit domestica. Questo apparecchio idoneo per miscelare, impastare e montare alimenti. Lapparecchio non deve essere utilizzato per lavorare altri oggetti o sostanze. Altri impieghi sono possibili se si utilizzano ulteriori accessori autorizzati dal produttore. Usare lapparecchio solo con gli accessori e i ricambi originali approvati. Non utilizzare mai le parti degli accessori con altri apparecchi. Usare lapparecchio solo in ambienti interni a temperatura ambiente e ad unaltitudine massima di 2000 m s.l.m.

Importanti avvertenze di sicurezza Leggere attentamente le istruzioni per luso, osservarle e conservarle! Se lapparecchio viene ceduto, allegare anche le presenti istruzioni. Linosservanza delle istruzioni per luso corretto dellapparecchio esclude la responsabilit del costruttore per i danni da essa derivanti. Questo apparecchio pu essere usato da persone con ridotte facolt psichiche, sensoriali o mentali o con conoscenze e/o esperienza insufficienti, purch siano sotto il controllo di persone adulte o siano state istruite sulluso sicuro dellapparecchio e abbiano compreso i pericoli connessi alluso dello stesso. I bambini devono essere tenuti lontani dallapparecchio e dal cavo di alimentazione e non devono utilizzare lapparecchio. I bambini non devono giocare con lapparecchio. La pulizia e la manutenzione a cura dellutente non devono essere eseguite da bambini.

W Pericolo di scossa elettrica e pericolo dincendio! Collegare e usare lapparecchio solo rispettando i dati della

targhetta didentificazione. Usare lapparecchio solo se il cavo di alimentazione e lapparecchio stesso non presentano danni. Al fine di evitare pericoli, le riparazioni dellapparecchio, come ad es. la sostituzione di un cavo di alimentazione danneggiato, devono essere eseguite solo dal nostro servizio assistenza clienti.

Accendere e spegnere lapparecchio solo con la manopola. Non collegare mai lapparecchio a timer o a prese telecomandate. Sorvegliare sempre lapparecchio durante il funzionamento!

Non disporre lapparecchio sopra oppure in prossimit di superfici molto calde, come per es. fornelli. Non mettere mai il cavo dalimentazione a contatto con parti calde o tirarlo sopra spigoli vivi.

Non immergere mai lapparecchio base in acqua n lavarlo in lavastoviglie. Non pulire con il vapore. Non usare lapparecchio con le mani bagnate.

47

itImportanti avvertenze di sicurezza

Lapparecchio va sempre scollegato dalla corrente elettrica dopo ogni utilizzo, se lasciato incustodito, prima del montaggio, dello smontaggio, della pulizia e in caso di guasti. W Pericolo di lesioni!

Prima di sostituire accessori o parti aggiuntive che durante il funzionamento si muovono, lapparecchio deve essere spento e staccato dalla corrente. Dopo avere spento lapparecchio, lingranaggio continua brevemente a girare. Attendere larresto completo dellingranaggio.

Non spostare il braccio oscillante quando lapparecchio in funzione.

Mettere in funzione gli utensili soltanto con la ciotola inserita, il coperchio chiuso e i coperchi di sicurezza applicati! Per lutilizzo degli accessori, montare la ciotola, il coperchio e i coperchi di sicurezza in base alle istruzioni!

Durante il funzionamento non introdurre mai le mani nella ciotola o nel pozzetto di riempimento. Non introdurre oggetti (ad es. cucchiai) nella ciotola o nel pozzetto di riempimento. Tenere lontano mani, capelli, abiti e altri utensili dalle parti in rotazione.

Non utilizzare mai contemporaneamente utensili e accessori o 2 accessori. Per luso degli accessori osservare sia il libretto distruzioni accluso sia le presenti istruzioni per luso.

Usare laccessorio solo completamente montato. Non assemblare mai laccessorio sullapparecchio base. Utilizzare laccessorio soltanto nellapposita posizione di lavoro.

Tenere le mani lontano dalle lame taglienti e dai bordi dei dischi sminuzzatori. Afferrare i dischi sminuzzatori solo sul bordo!

Non toccare a mani nude le lame del frullatore. Non introdurre mai le mani nel frullatore collegato! Non azionare

mai il frullatore senza il coperchio. Prestare cautela nel maneggiare lame affilate durante lo

svuotamento del contenitore e durante la pulizia. W Pericolo di ustioni!

Durante la lavorazione di frullati molto caldi, dal imbuto nel coperchio esce vapore.

W Pericolo di soffocamento! Non lasciare che i bambini giochino con il materiale di imballaggio.

W Attenzione! Si consiglia di non lasciare mai lapparecchio acceso pi a lungo di quanto necessario per la lavorazione dellalimento. Non fare girare a vuoto lapparecchio.

48

it Importanti avvertenze di sicurezza

Congratulazioni per lacquisto di questo nuovo apparecchio di produzione Bosch. Trovate ulteriori informazioni sui nostri prodotti nel nostro sito Internet.

Indice Uso corretto ..............................................46 Importanti avvertenze di sicurezza ...........46 Sistemi di sicurezza ..................................48 Guida rapida .............................................48 Posizioni di lavoro.....................................49 Uso ...........................................................50 Pulizia e cura ............................................54 Conservazione..........................................55 Rimedio in caso di guasti..........................55 Esempi dimpiego ....................................55 Accessori speciali .....................................57 Smaltimento..............................................57 Garanzia ...................................................57

W Importante! Lavare sempre a fondo lapparecchio dopo ogni utilizzo o dopo un lungo periodo di inattivit (X Pulizia e cura ved. pagina 54).

W Spiegazione dei simboli sullapparecchio o sugli accessori

i Seguire le indicazioni del libretto distruzioni.

Y Attenzione! Lame rotanti.

W Attenzione! Utensili rotanti. Non introdurre le mani nellapertura di aggiunta ingredienti.

Blocco di riaccensione In caso dinterruzione dellenergia elettrica, lapparecchio resta inserito, ma il motore dopo linterruzione non si riavvia. Per la riaccensione ruotare la manopola su P, poi accendere.

Sicurezza di sovraccarico Se durante luso il motore si spegne automaticamente, si attivata la protezione contro i sovraccarichi. Una causa possibile pu essere la lavorazione contemporanea di quantit eccessive di alimenti. Per il comportamento in caso di attivazione di un sistema di sicurezza vedi Rimedio in caso di guasto. Lapparecchio non ha bisogno di manutenzione.

Guida rapida Figura A: Apparecchio base 1 Pulsante di sblocco 2 Braccio oscillante

Funzione Easy Armlift per favorire il movimento del braccio verso lalto (vedi Posizioni di lavoro).

Sistemi di sicurezza Sicurezza daccensione Vedi tabella Posizioni di lavoro. Lapparecchio pu essere acceso nelle pos. 1 e 3 solo:

se la ciotola (11) stata inserita e ruotata fino allo scatto.

49

itPosizioni di lavoro

3 Interruttore rotante Dopo lo spegnimento (posizione P) lapparecchio va automaticamente nella posizione ottimale per il cambio degli utensili. P = spento M = Funzionamento pulse alla massima velocit, mantenere la manopola per la durata desiderata. Grado 1-7, velocit di lavoro: 1 = basso numero di giri lento, 7 = alto numero di giri veloce.

4 Spia di funzionamento Si accende durante il funzionamento (manopola su M oppure su 1-7). Lampeggia in caso di errori nelluso dellapparecchio, in caso di attivazione della sicurezza elettronica ed in caso di un difetto dellapparecchio, vedi il capitolo Rimedio in caso di guasti.

5 Coperchio di sicurezza ingranaggio Per rimuovere il coperchio di sicurezza ingranaggio premere nella parte posteriore e sollevare.

6 Ingranaggio per sminuzzatore continuo e spremiagrumi (Accessori speciali*). Applicare il coperchio di sicurezza, se lingranaggio non viene utilizzato.

7 Ingranaggio per utensili (frusta per mescolare, frusta per montare, gancio impastatore) e tritacarne (Accessori speciali*)

8 Coperchio di sicurezza ingranaggio frullatore

9 Motore per frullatore (Accessori speciali*) Applicare il coperchio di sicurezza, se lingranaggio del frullatore non viene utilizzato.

10 Avvolgicavo automatico Ciotola con accessori 11 Ciotola impastatrice di acciaio inox 12 Coperchio Utensili 13 Frusta Profi Flexi 14 Frusta per montare professionale 15 Braccio impastatore con spatola

16 Borsa portaccessori Per conservare gli utensili ed i dischi sminuzzatori.

Sminuzzatore continuo 17 Pestello 18 Coperchio con bocca di carico 19 Disco sminuzzatore

a Disco doppia funzione Profi Supercut spesso/sottile

b Disco grattugia fine/grossa c Disco a fori fini per grattugiare d Disco doppia funzione taglio/

grattugia* 20 Portadisco 21 Carcassa con apertura di uscita Frullatore* 22 Bicchiere frullatore 23 Coperchio 24 Imbuto * Se un accessorio non compreso nella fornitura, pu essere acquistato nel commercio e presso il servizio assistenza clienti.

Posizioni di lavoro Figura B: Attenzione! Usare lapparecchio solo se lutensile / accessorio secondo la seguente tabella applicato allingranaggio indicato nella posizione corretta ed in posizione di lavoro. Il gancio oscillante deve essere arrestato in ogni posizione. Avvertenza Il braccio oscillante dotato della funzione Easy Armlift, che favorisce suo sollevamento.

Regolazione della posizione di lavoro:

Premere il tasto di sblocco e muovere il braccio oscillante. Aiutare il movimento con una mano.

Muovere il braccio oscillante fino allarresto nella posizione desiderata.

50

it Uso

Posizione Ingranaggio Utensili / accessori

Velocit di lavoro

1 7

17

15

13

2 7 *

3 6 37

35

4

9 57

7 57

* Montare / smontare lo sbattitore, le fruste ed il gancio impastatore.

Uso W Pericolo di lesioni!

Inserire la spina di rete solo dopo che tutti i preparativi per il lavoro con lapparecchio sono stati conclusi. Attenzione! Usare lapparecchio solo con lutensile / accessorio in posizione di lavoro. Non fare funzionare lapparecchio a vuoto. Non esporre apparecchio ed accessori a fonti di calore. Le parti non sono idonee per luso in forno a microonde.

Al primo uso pulire accuratamente apparecchio ed accessori, vedi capitolo Pulizia e cura.

Preparazione Disporre lapparecchio base su una

superficie liscia e pulita. Estrarre il cavo con un solo movimento

continuo fino alla lunghezza desiderata (max. 100 cm) e rilasciarlo lentamente; il cavo si arresta (figura C). Ridurre la lunghezza di lavoro del cavo: tirare un poco il cavo e lasciarlo riavvolgere fino alla lunghezza desiderata. Tirare poi di nuovo un poco il cavo e rilasciarlo lentamente; il cavo si arresta.

Attenzione! Se il cavo si blocca, estrarlo completamente e poi lasciarlo riavvolgere.

Inserire la spina.

Ciotola ed utensili Osservare gli esempi dimpiego nella tabella. L

W Pericolo di lesioni da utensili in rotazione! Durante il funzionamento non introdurre mai le mani nella ciotola. Lavorare solo con il coperchio (12) applicato! Sostituire lutensile solo quando lingranaggio fermo dopo lo spegnimento lingranaggio gira ancora un poco per inerzia e si ferma nella posizione di sostituzione utensile. Muovere il braccio oscillante solo quando lutensile si fermato. Coprire sempre gli ingranaggi non utilizzati con gli appositi coperchi di sicurezza. Attenzione! Usare la ciotola solo per il lavoro con questo apparecchio. Frusta Profi Flexi (13) per mescolare impasti, ad es. impasti per torte, torte alla frutta ecc. e per incorporare ingredienti quali uvetta e cioccolato in pezzi Frusta per montare professionale (14) per montare albume duovo e panna (almeno il 30% di grassi) e per preparare la pasta biscotto

51

itUso

Braccio impastatore (15) per lavorare impasti, ad es. pasta lievitata, pasta per il pane, impasto per la pizza, pasta, impasti per dolci e per incorporare nellimpasto ingredienti come i semi Avvertenza importante per limpiego dello sbattitore (Figura D): Per mescolare nel modo migliore gli ingredienti, lo sbattitore deve essere quasi a contatto con il fondo della ciotola impastatrice. In caso contrario adattare la regolazione in altezza come segue:

Staccare la spina. Premere il pulsante di sblocco e

portare il braccio oscillante nella posizione 2.

Inserire lo sbattitore nellingra naggio fino allarresto.

Tenere ferma la frusta per montare e con la chiave fissa (8 mm) allentare il dado in senso orario.

Regolare laltezza ottimale mediante rotazione dello sbattitore: Ruotare in senso orario: sollevare. Ruotare in senso antiorario: abbassare

Premere il pulsante di sblocco e portare il braccio oscillante nella posizione 1.

Controllare laltezza dello sbatti tore, se necessario correggerla.

Quando laltezza corretta mente regolata, premere il pulsante di sblocco e portare il braccio oscillante nella posizione 2.

Tenere ferma la frusta per montare e stringere il dado con la chiave fissa (8 mm) in senso antiorario.

Lavoro con la ciotola e gli utensili (Figura E):

Premere il pulsante di sblocco e portare il braccio oscillante nella posizione 2.

Applicare la ciotola impastatrice: sovrapporre la ciotola impastatrice inclinata verso avanti e poi abbassarla, ruotare in senso antiorario fino allo scatto.

A seconda del compito di lavorazione, inserire fino allarresto nellingranaggio la frusta, lo sbattitore o il gancio impastatore.

Avvertenza: Per il gancio impastatore ruotare la spatola, finch il gancio impastatore non sarresta (figura E-4b).

Introdurre nella ciotola gli ingredienti da lavorare.

Premere il pulsante di sblocco e portare il braccio oscillante nella posizione 1.

Applicare il coperchio. Ruotare la manopola sulla velocit

desiderata. Aggiungere ingredienti

Spegnere lapparecchio con linterruttore rotante.

Aggiungere gli ingredienti attraverso lapertura di aggiunta nel coperchio.

oppure Rimuovere il coperchio. Premere il pulsante di sblocco e

portare il braccio oscillante nella posizione 2.

Introdurre gli ingredienti. Dopo il lavoro

Spegnere lapparecchio con linterruttore rotante.

Staccare la spina. Rimuovere il coperchio. Premere il pulsante di sblocco e

portare il braccio oscillante nella posizione 2.

Estrarre lutensile dallingranaggio.

Rimuovere la ciotola impastatrice. Pulire tutte le parti, vedi Pulizia e

cura.

Sminuzzatore continuo Osservare gli esempi dimpiego nella tabella. M

W Pericolo di lesioni! Tenere le mani lontano dalle lame taglienti e dai bordi dei dischi sminuzzatori. Afferrare i dischi sminuzzatori solo sul bordo!

52

it Uso

Montare / smontare lo sminuzzatore continuo solo ad ingranaggio fermo e spina di alimentazione estratta. Non introdurre le mani nel pozzetto di carico. Attenzione! Usare lo sminuzzatore continuo solo nello stato di montaggio completo. Non montare mai lo sminuzzatore continuo sullapparecchio principale. Usare lo sminuzzatore continuo solo nella posizione di funzionamento mostrata. Protezione da sovraccarico Bild F: Al fine di evitare maggiori danni allapparecchio in caso di sovraccarico sullo sminuzzatore continuo, lasse di azionamento dello sminuzzatore continuo dotato di un intaglio (punto di rottura prestabilita). In questo punto lasse di azionamento si spezza in caso di sovraccarico. Un nuovo portadisco con asse di azionamento pu essere acquistato presso il servizio assistenza clienti. Disco doppia funzione Profi Supercut spesso/sottile per tagliare alimenti a fette spesse o sottili, ad es. frutta e verdura. Identificazione:

Grosso = fette spesse Fine = fette sottili

Nota: non idoneo per la lavorazione di formaggio duro, pane, panini o cioccolato. Consiglio: tagliare le patate bollite solo a freddo. Disco grattugia fine/grossa per grattugiare finemente o grosso lanamente ad es. frutta, verdura o formag gio, come Gouda o Edamer. Identificazione:

2 = lato grosso 4 = lato fine

Nota: non idoneo per la lavorazione di noci o formaggio duro, ad es. parmigiano. Consiglio: grattugiare il formaggio tenero con il lato grosso.

Disco a fori fini per grattugiare per grattugiare alimenti, ad es. noci o formaggio duro, per es. parmigiano. Nota: non idoneo per la lavorazione di for maggio tenere e formaggio da taglio. Disco doppia funzione taglio/grattugia per grattugiare patate crude o per tagliarle a fette. Nota: non adatto per lavorare alimenti fibrosi, ad es. porri o mango. Lavoro con lo sminuzzatore continuo Bild G:

Premere il pulsante di sblocco e portare il braccio oscillante nella posizione 2.

Applicare la ciotola impastatrice: sovrapporre la ciotola impastatrice inclinata verso avanti e poi abbassarla, ruotare in senso antiorario fino allo scatto.

Premere il pulsante di sblocco e portare il braccio oscillante nella posizione 3.

Rimuovere il coperchio di sicurezza dallingranaggio dello sminuzzatore continuo (figura G-5a).

Tenere il portadisco sullestremit inferiore con le due punte rivolte verso lalto.

Deporre con precauzione il disco per affettare o il disco grattugia desiderato sulle punte del portadisco (figura G-6a). Nel caso di dischi doppia funzione prestare attenzione che il lato desiderato sia rivolto in alto.

Afferrare il portadisco sullestremit superiore ed introdurlo nella carcassa (figura G-6b).

Applicare il coperchio (attenzione al riferimento) e ruotarlo in senso orario fino allarresto.

Applicare lo sminuzzatore continuo sullingranaggio, come si mostra nella figura G-8, e ruotarlo in senso orario fino allarresto.

53

itUso

Ruotare la manopola sulla velocit desiderata.

Introdurre gli alimenti da lavorare nel pozzetto di carico e spingerli con il pestello.

Attenzione! Evitare un intasamento dellalimento tagliato nellapertura di uscita. Consiglio: per risultati di taglio uniformi tagliare prodotti a gambo sottile riuniti in mazzetti. Avvertenza: se nello sminuzzatore continuo dovessero restare attaccati alimenti da lavorare, spegnere il robot da cucina, estrarre la spina, attendere che lingranaggio sia fermo, rimuovere il coperchio dello sminuzzatore continuo e vuotare il pozzetto di carico. Dopo il lavoro

Spegnere lapparecchio con linterruttore rotante.

Ruotare lo sminuzzatore continuo in senso antiorario e rimuoverlo.

Ruotare il coperchio in senso antiorario e rimuoverlo.

Rimuovere il portadisco con il disco. A tal fine spingere da sotto lasse di azionamento con il dito (figura H).

Pulire le parti.

Frullatore Osservare gli esempi dimpiego nella tabella. N

W Pericolo di lesioni a causa di lame taglienti / ingranaggio in rotazione! Non introdurre mai le mani nel frullatore applicato! Rimuovere/applicare il coperchio solo quando il motore fermo! Mettere in funzione il frullatore solo completamente assemblato e con il coperchio applicato. Non fare girare a vuoto il frullatore.

W Pericolo di ustioni! Durante la lavorazione di frullati molto caldi, dal imbuto nel coperchio esce vapore.

Lavorare con il frullatore Figura J:

Premere il pulsante di sblocco e portare il braccio oscillante nella posizione 4.

Rimuovere il coperchio di sicu rezza dellingranaggio frullatore.

Applicare il bicchiere frullatore (riferimento sul manico allineato al riferimento dellapparecchio base) e ruotarlo in senso antiorario fino allarresto.

Introdurre gli ingredienti. Massima quantit di liquido = 1,25 litri; massima quantit di liquidi che formano schiuma o liquidi molto caldi = 0,75 litro.

Applicare il coperchio e ruotarlo in senso antiorario fino allarresto nellim pugnatura del frullatore. Il coperchio deve innestarsi.

Ruotare la manopola sulla velocit desiderata.

Aggiungere ingredienti Figura J-8:

Spegnere lapparecchio con linterruttore rotante.

Rimuovere il coperchio ed introdurre gli ingredienti

oppure togliere limbuto ed aggiungere un poco

alla volta gli ingredienti solidi attraverso lapertura di aggiunta

oppure introdurre gli ingredienti liquidi attra

verso limbuto. Dopo il lavoro

Spegnere lapparecchio con linterruttore rotante.

Ruotare il frullatore in senso orario e rimuoverlo.

Consiglio: il frullatore deve essere lavato preferibilmente subito dopo luso.

W Attenzione! Con alimenti non adatti lapparecchio pu danneggiarsi.

Non lavorare alimenti caldi con una tem peratura superiore a 70 C nel bicchiere frullatore.

54

it Pulizia e cura

Non lavorare ingredienti surgelati, tranne i cubetti di ghiaccio, se sono stati immersi in una quantit sufficiente di liquido.

Non lavorare alimenti contenenti parti dure. Prima della lavorazione di frutta con semi o con nocciolo (mele, pesche ecc.) rimuovere i semi o i noccioli.

Note Limitazioni per la lavorazione:

non sminuzzare alimenti quali mandorle, cipolle, prezzemolo e carne.

Il frullatore non idoneo per produrre mousse spalmabili come il burro di arachidi, burro di cocco o salsa di noci.

Mescolare gli alimenti solidi utilizzando una quantit sufficiente di liquido.

Prima di frullare, mescolare i cibi in polvere con una quantit di liquido sufficiente oppure farli sciogliere com pletamente. I cibi in polvere sono ad es. lo zucchero a velo, il cacao in polvere, semi di soia tostati, farina, integratori proteici.

Pulizia e cura Le parti degli accessori utilizzate vanno lavate accuratamente dopo ogni utilizzo. X Tabella O Attenzione! Non utilizzare detergenti abrasivi. Possibili danni alle superfici.

Pulire lapparecchio base W Rischio di scossa elettrica!

Non immergere mai lapparecchio base in acqua, n lavarlo sotto acqua corrente. Non usare pulitrici a getto di vapore.

Staccare la spina. Pulire lapparecchio base ed i coperchi

di sicurezza ingranaggi con un panno umido. Se necessario utilizzare un poco di detersivo per stoviglie.

Infine asciugare lapparecchio.

Pulire la ciotola impastatrice e lutensile Ciotola impastatrice ed utensili sono lavabili in lavastoviglie. Non incastrare le parti di plastica nella lavastoviglie, poich questo durante il lavaggio potrebbe causare deformazioni permanenti!

Pulire lo sminuzzatore continuo W Pericolo di lesioni da lame taglienti!

Tenere le mani lontano dalle lame taglienti e dai bordi dei dischi sminuzzatori. Per la pulizia usare una spazzola. Tutte le parti dello sminuzzatore continuo sono lavabili in lavastoviglie. Consiglio: per la rimozione della patina rossa dopo la lavorazione, per es. delle carote, mettere un poco di olio alimentare su un panno e con questo strofinare lo sminuzzatore continuo (non i dischi sminuzzatori). Lavare poi lo sminuzzatore continuo.

Pulire il frullatore W Pericolo di lesioni da lame taglienti!

Non toccare a mani nude le lame del frullatore. Il bicchiere frullatore, il coperchio e limbuto sono lavabili in lavastoviglie. Consiglio: dopo la lavorazione di liquidi spesso sufficiente lavare il frullatore senza separarlo dallapparecchio. A tal fine introdurre 700 ml di acqua con una goccia di detersivo nel frullatore montato. Accendere il frullatore per ca. 1 minuto (velocit 7). Versare via lacqua e sciac quare il frullatore con acqua pulita. Avvertenza importante Se necessario lavare la borsa portaccessori. Osservare le indicazioni per il trattamento nella borsa.

55

itConservazione

Conservazione W Pericolo lesioni!

Quando lapparecchio non in uso estrarre la spina di rete. Figura K:

Riporre gli utensili ed i dischi sminuzza tori nella borsa portaccessori.

Conservare la borsa portaccessori nella ciotola.

Rimedio in caso di guasti W Pericolo lesioni!

Prima di riparare un guasto, estrarre la spina dalimentazione. Avvertenza importante Un errore nelluso dellapparecchio, unattivazione della sicurezza elettronica oppure un difetto dellapparecchio viene visualizzato dallintermittenza della spia di funzionamento. Il gancio oscillante deve essere arrestato in ogni posizione. Provare prima a risolvere il problema insorto con laiuto delle istruzioni seguenti. Guasto Lapparecchio non si avvia. Rimedio

Controllare lalimentazione elettrica. Controllare la spina di alimentazione. Controllare il braccio oscillante.

Posizione corretta? Braccio in arresto? Ruotare il frullatore o la ciotola

impastatrice fino allarresto. Applicare il coperchio del frullatore e

ruotarlo fino allarresto. Applicare il coperchio di sicurezza

ingranaggio sugli ingranaggi non utilizzati.

attivo il blocco di riaccensione. Disporre linterruttore su P e poi indietro sul grado desiderato.

Guasto Lapparecchio si spegne durante luso. La sicurezza di sovraccarico si atti vata. Sono stati lavorati troppi alimenti contemporaneamente.

Rimedio Spegnere lapparecchio. Ridurre la quantit di lavorazione.

Guasto Ad ingranaggio in rotazione stato azionato per errore il pulsante di sblocco. Il braccio oscillante si solleva. Lingranaggio si disinserisce, ma non resta fermo nella posizione di cambio utensile. Rimedio

Ruotare la manopola su P. Portare il braccio nella

posizione 1. Accendere lapparecchio

(velocit 1). Spegnere di nuovo lapparecchio.

Lutensile resta fermo nella posizione di cambio utensile. Guasto Il frullatore comincia a non funzionare o si ferma durante luso, lingranaggio ronza. La lama bloccata. Rimedio

Spegnere lapparecchio ed estrarre la spina dalimentazione.

Rimuovere il frullatore e togliere lostacolo.

Applicare di nuovo il frullatore. Accendere lapparecchio.

Avvertenza importante Se non fosse possibile eliminare il guasto, rivolgesi al servizio assistenza clienti.

Esempi dimpiego Seguire le raccomandazioni generali nelle tabelle L, M e N. Non superare le quantit massime ammesse.

Pasta biscotto Ricetta base 2 uova 23 cucchiai acqua calda 100 g zucchero 1 bustina zucchero vanigliato 70 g farina 70 g fecola

56

it Esempi dimpiego

eventualmente lievito in polvere Montare gli ingredienti (tranne farina

e fecola) con lo sbattitore per ca. 46 minuti alla velocit 7.

Disporre linterruttore rotante sul grado 1 e mescolare farina e fecola passate al setaccio, 1 cucchiaio per volta, in un tempo da ca. a 1 minuto.

Quantit massima: 2 volte la ricetta base

Pasta fluida miscelata Ricetta base 6 uova 500 g zucchero 1 pizzico sale 2 bustine zucchero vanigliato o

buccia di limone 500 g burro o margarina

(a temperatura ambiente) 1000 g farina 1 bustina di lievito in polvere 250 ml latte Mescolare uova, zucchero, sale e

zucchero vanigliato o buccia di limone con la frusta per ca. 10 secondi alla velocit 1.

Impostare la velocit 5 e lavorare per ca. 120 secondi.

Aggiungere il burro e lavorare per ca. 60 secondi alla velocit 3.

Aggiungere la farina e il lievito in polvere e lavorare per ca. 2 minuti alla velocit 1.

Impostare la velocit 3 e aggiungere lentamente il latte durante i 2 minuti successivi.

Quantit massima: 1 volta la dose della ricetta base

Torta alla frutta Ricetta base 3 uova 135 g di zucchero 135 g di margarina 255 g di farina 10 g di lievito in polvere 150 g di uvetta di Corinto 150 g di frutta secca mista Inserire la frusta per mescolare.

Versare tutti gli ingredienti tranne la frutta secca.

Frullare per 30 secondi alla velocit 1. Quindi lavorare per 35 minuti alla

velocit 5. Portare alla velocit 2. Entro 3060 secondi aggiungere la frutta

secca. Quantit massima: 2 volta la ricetta base

Pasta frolla Ricetta base 125 g burro

(a temperatura ambiente)

100125 g zucchero 1 uovo 1 pizzico sale un poco di buccia di limone o zucchero vanigliato 250 g farina eventualmente lievito in polvere Lavorare tutti gli ingredienti con la frusta

per ca. minuto alla velocit 1, poi ca. 36 minuti alla velocit 3.

A partire da 250 g di farina: Mescolare tutti gli ingredienti con i

gancio impastatore per ca. minuto alla velocit 1, poi ca. 56 minuti alla velocit 3.

Quantit massima: 2 volte la ricetta base

Pasta con lievito per dolce Ricetta base 500 g farina 1 uovo 80 g burro (a temperatura ambiente) 80 g zucchero 200250 ml latte tiepido 25 g di lievito fresco o 1 pacchetto di

lievito secco Buccia di limone 1 pizzico sale Lavorare tutti gli ingredienti per

ca. minuto alla velocit 1, poi per ca. 36 minuti con il gancio impastatore alla velocit 3.

Quantit massima: 2 volte la ricetta base

57

itAccessori speciali

Pasta Ricetta base 300 g farina 3 uova secondo necessit 12 cucchiai

(1020 g) di acqua fredda Lavorare tutti gli ingredienti da 3 a

5 minuti circa alla velocit 3 in una pasta.

Quantit massima: 1,5 volte la ricetta base

Pasta per pane Ricetta base 1000 g farina 2 confezioni lievito secco 2 cucchiaini sale 600650 ml acqua calda Lavorare tutti gli ingredienti per

ca. minuto alla velocit 1, poi per ca. 67 minuti con il gancio impastatore alla velocit 3.

Maionese 1 uovo 1 cucchiaino di senape l di olio 1 cucchiaio di succo di limone o aceto 1 pizzico di sale 1 pizzico di zucchero

Gli ingredienti devono essere a temperatura ambiente. La maionese pu essere prepa rata soltanto con uova intere.

Mescolare gli ingredienti (tranne lolio) nel frullatore per qualche secondo alla velocit 3 oppure 4.

Commutare il frullatore alla velocit 7 e versare lentamente lolio attraverso il bicchierino dosatore e continuare mescolare fino ad emulsionare la maionese.

Consumare la maionese subito. Non conservarla.

Accessori speciali Gli accessori speciali possono essere acquistati presso il servizio clienti, i riven ditori specializzati o su Internet. Utilizzare solo gli accessori originali, i quali sono stati progettati appositamente per lapparecchio. Gli accessori sono specifici dellapparec chio. Al momento dellacquisto indicare sempre il codice prodotto preciso (ENr.) dellapparecchio. Per conoscere gli accessori disponibili per il proprio apparecchio consultare il catalogo, il punto vendita online o il servizio clienti. www.bosch-home.com

Smaltimento

J Si prega di smaltire le confezioni nel rispetto dellambiente. Questo apparecchio dispone di contrassegno ai sensi della direttiva europea 2012/19/UE in materia di apparecchi elettrici ed elettronici (waste electrical and electronic equipment WEEE). Questa direttiva definisce le norme per la raccolta e il riciclaggio degli apparecchi dismessi valide su tutto il territorio dellUnione Europea. Informarsi presso il rivenditore specializzato sulle attuali disposizioni per la rottamazione.

Garanzia Per questo apparecchio sono valide le condizioni di garanzia pubblicate dal nostro rappresentante nel paese di vendita. Il rivenditore, presso il quale stato acquistato lapparecchio, sempre ben disposto a fornire a richiesta informazioni a proposito. Per lesercizio del diritto di garanzia comunque necessario presen- tare il documento di acquisto.

Con riserva di modifica.

58

nl Bestemming van het apparaat

Bestemming van het apparaat Dit apparaat is alleen bestemd voor huishoudelijk gebruik en de huiselijke omgeving. Gebruik het apparaat uitsluitend voor verwerkingshoeveelheden en tijden die gebruikelijk zijn in het huishouden. Het apparaat is geschikt voor het mixen, kneden en kloppen van levensmiddelen. Het apparaat mag niet worden gebruikt om andere substanties of voorwerpen te verwerken. Bij gebruik van door de fabrikant goedgekeurde andere accessoires zijn aanvullende toepassingen mogelijk. Het apparaat uitsluitend met goedgekeurde originele onderdelen en accessoires gebruiken. De toebehoren nooit voor andere apparaten gebruiken. Gebruik het apparaat alleen binnenshuis bij kamertemperatuur en tot 2000 m boven de zeespiegel.

Belangrijke veiligheidsinstructies Lees de gebruiksaanwijzing zorgvuldig door, houd u eraan en bewaar hem goed! Als u dit apparaat aan iemand anders geeft, lever dan ook deze gebruiksaanwijzing mee. Bij nietnaleving van de aanwijzingen voor het juiste gebruik van het apparaat is de fabrikant niet aansprakelijk voor daaruit resulterende schade. Dit apparaat mag door personen met verminderde lichamelijke, zintuiglijke of geestelijke vermogens of gebrek aan ervaring en/of kennis worden gebruikt indien dit onder toezicht gebeurt of indien zij over het veilige gebruik van het apparaat zijn genstrueerd en de hieruit voortvloeiende gevaren hebben begrepen. Kinderen moeten van het apparaat en aansluitsnoer worden weggehouden en mogen het apparaat niet bedienen. Kinderen mogen niet met het apparaat spelen. Reiniging en gebruikersonderhoud mogen niet door kinderen worden uitgevoerd.

W Gevaar voor elektrische schokken en brand! Het apparaat uitsluitend aansluiten en gebruiken volgens de

gegevens op het typeplaatje. Alleen gebruiken wanneer het aansluitsnoer en het apparaat niet beschadigd zijn. Om gevaren te vermijden, mogen reparaties aan het apparaat, zoals het vervangen van een beschadigd aansluitsnoer, uitsluitend worden uitgevoerd door onze klantenservice.

Het apparaat uitsluitend in en uitschakelen met de draaischakelaar.

Het apparaat nooit aansluiten op een tijdschakelaar of op een op afstand bedienbaar stopcontact. Tijdens het gebruik altijd toezicht houden op het apparaat!

59

nlBelangrijke veiligheidsinstructies

Het apparaat niet neerzetten op of in de buurt van hete oppervlakken, zoals fornuisplaten. Het netsnoer niet met hete delen in aanraking brengen of over scherpe randen trekken.

Het basisapparaat niet in water dompelen en niet in de vaatwasser doen. Gebruik geen stoomreiniger. Het apparaat niet met vochtige handen gebruiken.

Het apparaat moet na ieder gebruik, als er geen toezicht aanwezig is, voor de montage, demontage of reiniging en bij storingen altijd van het net worden gescheiden. W Gevaar voor letsel!

Voordat u toebehoren of hulpstukken vervangt die bewegen tijdens het gebruik, moet het apparaat worden uitgeschakeld en worden losgemaakt van het stroomnet. Na het uitschakelen loopt de aandrijving nog even na. Wacht tot de aandrijving geheel stilstaat.

Verstel de draaiarm niet wanneer het apparaat ingeschakeld is. Hulpstukken alleen gebruiken als de kom is geplaatst, het deksel

is aangebracht en het aandrijvingsbeschermdeksel is geplaatst! Bij gebruik van toebehoren de kom, het deksel en het aandrij vingsbeschermdeksel volgens de gebruiksaanwijzing aanbrengen!

Tijdens het gebruik nooit met de handen in de kom of in de vulopening grijpen. Geen voorwerpen (bijv. kooklepel) in de kom of de vulopening steken. Handen, haren, kleding en andere voorwerpen op een afstand houden van roterende delen.

Hulpstukken nooit gelijktijdig met een of 2 toebehoren gebruiken. Neem bij gebruik van toebehoren zowel deze als ook de bijgevoegde gebruiksaanwijzingen in acht.

De toebehoren alleen in compleet samengebouwde toestand gebruiken. Toebehoren nooit samenbouwen terwijl het op het basisapparaat is aangebracht. Toebehoren alleen gebruiken in de hiervoor bestemde werkstand.

Niet in de scherpe messen en randen van de fijnmaakschijven grijpen. Fijnmaakschijven alleen aan de rand vastpakken!

Mixermes niet met blote handen reinigen. Grijp nooit in de aangebrachte mixer! Gebruik de mixer nooit als

het deksel niet is aangebracht. Voorzichtig bij de omgang met de scherpe messen, bij het legen

van het reservoir en bij het reinigen. W Gevaar voor brandwonden!

Bij verwerking van hete mixvloeistoffen komt er stoom uit de trechter in het deksel.

W Verstikkingsgevaar! Laat kinderen niet met verpakkingsmateriaal spelen.

60

nl Belangrijke veiligheidsinstructies

Hartelijk gefeliciteerd met de aankoop van uw nieuwe Bosch-apparaat. Meer informatie over onze producten vindt u op onze internetsite.

Inhoud Bestemming van het apparaat..................58 Belangrijke veiligheidsinstructies ..............58 Veiligheidssystemen .................................60 In n oogopslag ......................................61 Bedrijfsposities .........................................61 Bedienen ..................................................62 Reiniging en onderhoud ...........................66 Opbergen..................................................66 Hulp bij storingen ......................................67 Toepassingsvoorbeelden .........................67 Speciale accessoires ................................69 Afval..........................................................69 Garantie ....................................................69

W Attentie! Wij adviseren u het apparaat niet langer ingeschakeld te laten dan nodig is voor het verwerken van het levensmiddel. Niet onbelast laten lopen.

W Belangrijk! Na elk gebruik of als u het apparaat langere tijd niet hebt gebruikt, dient u het altijd grondig te reinigen (X Reiniging en onderhoud zie pagina 66).

W Toelichting bij de symbolen op het apparaat en het toebehoren

i Aanwijzingen in de gebruiksaanwijzing opvolgen.

Y Voorzichtig! Draaiende messen.

W Voorzichtig! Draaiende hulpstukken. Niet in de vulopening grijpen.

Veiligheidssystemen Inschakelbeveiliging Zie tabel Bedrijfsposities. Het apparaat kan in positie 1 en 3 alleen worden ingeschakeld:

wanneer de kom (11) is aangebracht en vastgeklikt door deze te draaien.

Beveiliging tegen opnieuw inschakelen Bij een stroomstoring blijft het apparaat ingeschakeld, maar na de stroomstoring gaat de motor niet opnieuw lopen. Opnieuw inschakelen: draaischakelaar op 0/off draaien, dan inschakelen.

Overbelastingsbeveiliging Als de motor zichzelf tijdens het gebruik uitschakelt, is de overbelastingsbeveiliging geactiveerd. Een mogelijke oorzaak is het verwerken van een te grote hoeveelheid levensmiddelen tegelijk. Wat u moet doen indien een veiligheidssysteem wordt geactiveerd, zie Hulp bij storingen. Het apparaat behoeft geen verzorging.

61

nlIn n oogopslag

In n oogopslag Afb. A: Basisapparaat 1 Ontgrendelknop 2 Draaiarm

Easy Armliftfunctie ter ondersteuning van de opwaartse beweging van de arm (zie Bedrijfsposities).

3 Draaiknop Na uitschakeling (stand 0/off) wordt het apparaat automatisch op de optimale positie voor het verwisselen van de hulpstukken gezet. 0/off = Stop M = Momentschakeling met hoogste toerental, schakelaar gedurende de gewenste mixduur vasthouden. Stand 1-7, draaisnelheid: 1 = laag toerental langzaam, 7 = hoog toerental snel.

4 Functie-indicatie Brandt tijdens het gebruik (draaischakelaar op M of 1-7). Knippert bij een bedieningsfout van het apparaat, bij activering van de elektronische zekering en bij een apparaatdefect, zie het hoofdstuk Hulp bij storingen.

5 Aandrijvingsbeschermingsdeksel Om het aandrijvingsbeschermdeksel te verwijderen op het achterste gedeelte drukken en het deksel verwijderen.

6 Aandrijving voor doorloopsnijder en citruspers (extra toebehoren*). Het aandrijvingsbeschermingsdeksel aanbrengen als de aandrijving niet wordt gebruikt.

7 Aandrijving voor hulpstukken (roergarde, klopgarde, kneedhaak) en vleesmolen (extra toebehoren*)

8 Aandrijvingsbeschermdeksel mixer 9 Aandrijving voor mixer

(extra toebehoren*) Het aandrijvingsbeschermingsdeksel mixer aanbrengen als de aandrijving niet wordt gebruikt.

10 Automatische snoeropwikkeling

Mengkom met toebehoren 11 Roestvrijstalen kom 12 Deksel Hulpstukken 13 Roergarde Profi Flexi 14 Professionele garde 15 Kneedhaak met deegvanger 16 Opbergzak

Voor het opbergen van de hulpstukken en de fijnmaakschijven.

Doorloopsnijder 17 Stopper 18 Deksel met vulschacht 19 Fijnmaakschijven

a Draaischijf Profi Supercut dik/dun b Raspschijf grof/fijn c Maalschijf fijn d Snij/raspschijf*

20 Schijfhouder 21 Behuizing met uitlaatopening Mixer* 22 Mixkom 23 Deksel 24 Trechter * Indien een van de toebehoren niet is meegeleverd, kan het in de speciaalzaak of bij de servicedienst worden aangeschaft.

Bedrijfsposities Afb. B: Attentie! Het apparaat alleen gebruiken wanneer het hulpstuk/toebehoren volgens deze tabel op de juiste aandrijving en in de juiste positie is aangebracht en op de bedrijfsstand staat. De draaiarm moet in elke bedrijfspositie zijn vastgeklikt. Aanwijzing De draaiarm beschikt over een Easy Armliftfunctie, die de opwaartse beweging van de draaiarm ondersteunt.

Instellen van de bedrijfspositie: Ontgrendelknop indrukken en de

draaiarm draaien. De beweging met een hand ondersteunen.

62

nl Bedienen

De draaiarm op de gewenste positie zetten en laten vastklikken.

Positie Aandrijving Hulpstuk/ toebeho- ren

Werksnel- heid

1 7

17

15

13

2 7 *

3 6 37

35

4

9 57

7 57

* Aanbrengen / verwijderen van de klop garde, roergarde en kneedhaak.

Bedienen W Gevaar voor letsel!

De stekker pas in het stopcontact steken wanneer alle voorbereidingen voor het werken met het apparaat zijn uitgevoerd. Attentie! Het apparaat alleen met het toebehoren/ hulpstuk in de bedrijfsstand gebruiken. Het apparaat niet zonder ingredinten gebruiken. Apparaat en toebehoren niet blootstellen aan warmtebronnen. De onderdelen zijn niet geschikt voor gebruik in een magnetron.

Het apparaat en het toebehoren grondig reinigen voordat u ze in gebruik neemt, zie Reiniging en onderhoud.

Voorbereiden Het basisapparaat op een vlakke en

schone ondergrond zetten. Het snoer in n keer tot de gewenste

lengte uittrekken (max. 100 cm) en langzaam loslaten; het snoer is gearrteerd (afb. C).

Werklengte van het snoer korter maken: lichtjes aan het snoer trekken en laten opwikkelen tot de gewenste lengte. Dan opnieuw kort aan het snoer trekken en langzaam loslaten; het snoer is gearrteerd.

Attentie! Wanneer het snoer klem zit: het snoer geheel afwikkelen en dan laten opwikkelen.

Stekker in wandcontactdoos doen.

Kom en hulpstukken Neem de toepassingsvoorbeelden in de tabel in acht. L

W Verwondingsgevaar door roterende hulpstukken! Grijp tijdens het gebruik nooit in de mengkom. Altijd werken met aangebracht deksel (12)! Hulpstuk alleen vervangen bij stilstaande aandrijving na het uitschakelen loopt de aandrijving nog even na en blijft dan staan op de hulpstukwisselpositie. De draaiarm pas bewegen wanneer het hulpstuk stilstaat. Nietgebruikte aandrijvingen altijd afdekken met aandrijvingsbeschermdeksels. Attentie! Kom alleen gebruiken voor werkzaamheden met dit apparaat. Roergarde Profi Flexi (13) voor het roeren van deeg, bijv. taartdeeg, fruittaart enz. en voor het mengen van ingredinten, zoals rozijnen en stukjes chocolade

63

nlBedienen

Professionele garde (14) voor het kloppen van eiwit en slagroom (minstens 30 % vetgehalte) en voor het mengen van biscuitdeeg Kneedhaak (15) voor het kneden van dag, bijv. gistdeeg, brooddeeg, pastadeeg, gebakdeeg en voor het mengen van ingredinten zoals zaden in het deeg Belangrijke aanwijzing over het gebruik van de klopgarde (Afb. D): Om de ingredinten optimaal te mengen, dient de klopgarde de bodem van de kom bijna te raken. Als dit niet het geval is, past u de hoogteinstelling van de klopgarde als volgt aan:

Stekker uit het stopcontact halen. Ontgrendelknop indrukken en

de draaiarm op positie 2 zetten. Klopgarde in de aandrijving

steken tot deze vastklikt. Garde vasthouden en de moer m.b.v.

een muilsleutel (SW 8) met de klok mee losdraaien.

De optimale hoogte van de klopgarde instellen door de garde te draaien: met de klok mee draaien: optillen. tegen de klok in draaien: neerlaten

Ontgrendelknop indrukken en de draaiarm op positie 1 zetten.

De hoogte van de klopgarde testen en indien nodig corrigeren.

Wanneer de hoogte goed is ingesteld, op de ontgrendelknop drukken en de draaiarm op positie 2 zetten.

Garde vasthouden en de moer m.b.v. een steeksleutel (SW 8) tegen de klok in vastdraaien.

Werken met de kom en de hulpstukken (Afb. E):

Ontgrendelknop indrukken en de draaiarm op positie 2 zetten.

Kom aanbrengen: Kom iets naar voren laten overhellen, plaatsen en vastklikken door deze tegen de klok in te draaien.

Afhankelijk van de uit te voeren taak de roergarde, slaggarde of kneedhaak in de aandrijving steken tot deze vastklikt.

Aanwijzing: Bij de kneedhaak de deegvanger draaien tot de kneedhaak kan worden vastgeklikt (afb. E-4b).

De ingredinten in de kom doen. Ontgrendelknop indrukken en

de draaiarm op positie 1 zetten. Deksel aanbrengen. Draaischakelaar op de

gewenste stand zetten. Ingredinten toevoegen

Apparaat uitschakelen met de draaischakelaar.

Ingredinten toevoegen via de vulope ning in het deksel.

of Deksel verwijderen. Ontgrendelknop indrukken en

de draaiarm op positie 2 zetten. Ingredinten toevoegen.

Na gebruik Apparaat uitschakelen met de

draaischakelaar. Stekker uit het stopcontact halen. Deksel verwijderen. Ontgrendelknop indrukken en

de draaiarm op positie 2 zetten. Hulpstuk uit de aandrijving

trekken. Kom verwijderen. Alle onderdelen reinigen,

zie Reiniging en onderhoud.

64

nl Bedienen

Doorloopsnijder Neem de toepassingsvoorbeelden in de tabel in acht. M

W Gevaar voor letsel! Niet in de scherpe messen en randen van de fijnmaakschijven grijpen. Fijnmaakschijven alleen aan de rand vast pakken! Doorloopsnijder alleen aanbren gen/verwijderen wanneer de aandrijving stilstaat en de stekker uit het stopcontact is getrokken. Niet in de vulschacht grijpen. Attentie! Doorloopsnijder alleen in compleet samengebouwde toestand gebruiken. Doorloopsnijder nooit samenbouwen terwijl het op het basisapparaat is aangebracht. Doorloopsnijder alleen gebruiken in de afgebeelde bedrijfspositie. Beveiliging tegen overbelasting Afb. F: Om bij overbelasting van de doorloopsnijder grotere schade aan uw apparaat te voorkomen, is de aandrijfas van de doorloopsnijder voorzien van een inkerving (breekpunt). Bij overbelasting breekt de aandrijfas op dit punt. Een nieuwe schijfhouder met aandrijfas is verkrijgbaar bij de servicedienst. Draaischijf Profi Supercut dik/dun voor het snijden van levensmiddelen in dikke of dunne plakken, bijv. fruit en groente. Aanduiding:

Grof = dikke plakken Fijn = dunne plakken

Aanwijzing: niet geschikt voor de verwer king van harde kaas, brood, broodjes of chocolade. Tip: snij gekookte aardappelen pas nadat ze zijn afgekoeld. Raspschijf grof/fijn voor het raspen van levensmid delen in grove of fijne stukken, bijv. fruit, groente of kaas, zoals Goudse of Edammer kaas.

Aanduiding: 2 = grove zijde 4 = fijne zijde

Aanwijzing: niet geschikt voor de verwer king van noten of harde kaas, bijv. Parme zaanse kaas. Tip: rasp zachte kaas met de grove zijde. Maalschijf fijn voor het raspen van levensmid delen fijn, bijv. noten of harde kaas, zoals Parmezaanse kaas. Aanwijzing: niet geschikt voor de verwer king van zachte kaas en snijdbare kaas. Snij-/raspschijf voor het raspen van rauwe aardap pelen of voor het snijden in plakjes. Aanwijzing: niet geschikt voor het verwer ken van vezelachtige levensmiddelen, bijv. prei of mango. Werken met de doorloopsnijder Afb. G:

Ontgrendelknop indrukken en de draaiarm op positie 2 zetten.

Kom aanbrengen: Kom iets naar voren laten over hellen, plaatsen en vastklikken door deze tegen de klok in te draaien.

Ontgrendelknop indrukken en de draaiarm op positie 3 zetten.

Aandrijvingsbeschermdeksel verwijderen van de aandrijving van de doorloopsnijder (afb. G-5a).

De schijfhouder onderaan vasthouden, daarbij moeten de twee punten naar boven wijzen.

De gewenste snij of raspschijf voorzich tig op de punten van de schijfhouder leggen (afb. G-6a). Bij draaischijven erop letten dat de gewenste zijde naar boven wijst.

Schijfhouder bovenaan vastpakken en in de behuizing aanbrengen (afb. G-6b).

Deksel aanbrengen (markering in acht nemen) en tot aan de aanslag met de klok mee draaien.

65

nlBedienen

Doorloopsnijder volgens afb. G-8 op de aandrijving plaatsen en met de klok mee tot aan de aanslag draaien.

Draaischakelaar op de aanbevolen stand zetten.

De te verwerken levensmiddelen in de vulschacht doen en aandrukken met de stopper.

Attentie! Zorgen dat het gesneden product zich niet ophoopt in de uitlaatopening. Tip: Voor een gelijkmatig snijresultaat kunt u dun snijgoed het best gebundeld verwerken. Opmerking: Als er levensmiddelen vast komen te zitten in de doorloopsnijder, dient u de keukenmachine uit te schakelen en de stekker uit het stopcontact te trekken. Dan wacht u tot de aandrijving stilstaat, neemt u het deksel van de doorloopsnijder en maakt u de vulschacht leeg. Na gebruik

Apparaat uitschakelen met de draaischakelaar.

Doorloopsnijder tegen de klok in draaien en verwijderen.

Deksel tegen de klok in draaien en verwijderen.

Schijfhouder met schijf verwijderen. Daartoe met de vinger van onderaf tegen de aandrijfas drukken (afb. H).

Onderdelen reinigen.

Mixer Neem de toepassingsvoorbeelden in de tabel in acht. N

W Verwondingsgevaar door scherpe messen/roterende aandrijving! Grijp niet in de aangebrachte mixer! De mixer alleen verwijderen of aanbrengen wanneer de aandrijving stilstaat! Gebruik de mixer uitsluitend in samengebouwde toestand en met aangebracht deksel. Mixer niet zonder vulling laten lopen.

W Risico van brandwonden! Bij verwerking van hete mixvloeistoffen komt er stoom uit de trechter in het deksel.

Werken met de mixer Afb. J:

Ontgrendelknop indrukken en de draaiarm op positie 4 zetten.

Het beschermdeksel van de mixeraandrijving verwijderen.

Mixkom aanbrengen (markering op de handgreep tegen de markering op het basisapparaat) en tegen de klok in draaien tot aan de aanslag.

Ingredinten toevoegen. Maximumhoeveelheid vloeistof = 1,25 liter; maximumhoeveelheid schuimende of hete vloeistof = 0,75 liter.

Deksel aanbrengen en tegen de klok in tot aan de aanslag in de mixerhandgreep draaien. Het deksel moet vastgeklikt zijn.

Draaischakelaar op de gewenste stand zetten.

Ingredinten toevoegen Afb. J-8:

Apparaat uitschakelen met de draaischakelaar.

Deksel verwijderen en de ingredinten toevoegen

of trechter verwijderen en vaste

ingredinten beetje bij beetje toevoegen via de vulopening

of vloeibare ingredinten toevoegen via de

trechter. Na gebruik

Apparaat uitschakelen met de draaischakelaar.

Mixer met de klok mee draaien en verwijderen.

Tip: U kunt de mixer het best direct na gebruik reinigen.

W Attentie! Door ongeschikte levensmiddelen kan het apparaat beschadigd raken.

Geen hete levensmiddelen heter dan 70 C in de mengbeker verwerken.

Geen diepvriesproducten verwerken, met uitzondering van ijsblokjes als die in een voldoende grote hoeveelheid vloeistof werden gedaan.

66

nl Reiniging en onderhoud

Geen levensmiddelen verwijderen die harde bestanddelen bevatten. Vr de verwerking van pit en steenvruchten (appels, perziken enz.) moeten de pitten/stenen worden verwijderd.

Aanwijzingen Beperkingen voor de verwerking:

Geen ingredinten zoals amandelen, uien, peterselie of vlees verkleinen.

De menger kan geen smeerbeleg zoals pindakaas, cocosnootboter of noten pasta maken.

Vaste levensmiddelen met voldoende vloeistof mengen.

Poedervormige levensmiddelen vr het mixen met voldoende vloeistof mengen of volledig in vloeistof oplossen. Poedervormige levensmiddelen zijn bijv. poedersuiker, cacaopoeder, geroosterde sojabonen, meel, eiwitpoeder.

Reiniging en onderhoud Het gebruikte toebehoren moet na elk gebruik grondig worden gereinigd. X tabel O Attentie! Geen schurende reinigingsmiddelen gebruiken. De oppervlakken kunnen beschadigd raken.

Basisapparaat reinigen W Gevaar voor elektrische schok!

Het basisapparaat nooit in water dompelen of onder stromend water houden. Geen stoomreiniger gebruiken.

Stekker uit het stopcontact halen. Basisapparaat en

aandrijvingsbeschermdeksel afvegen met een vochtige doek. Indien nodig een beetje afwasmiddel gebruiken.

Daarna het apparaat afdrogen.

Kom en hulpstukken reinigen De kom en de hulpstukken kunnen in de afwasautomaat worden gereinigd. Kunststof onderdelen niet vastklemmen in de afwasautomaat, omdat ze dan onherstelbaar vervormd kunnen raken!

Doorloopsnijder reinigen W Verwondingsgevaar door scherpe messen!

Niet in de scherpe messen en randen van de fijnmaakschijven grijpen. Voor het reinigen een borstel gebruiken. Alle onderdelen van de doorloopsnijder kunnen in de afwasautomaat worden gereinigd. Tip: Om na het verwerken van bijv. wortels het rode laagje te verwijderen, kunt u een beetje slaolie op een doek doen en daarmee de doorloopsnijder (niet de fijnmaakschijven) schoonwrijven. Daarna de doorloopsnijder afwassen.

Mixer reinigen W Verwondingsgevaar door

scherpe messen! Raak het mixermes niet met blote handen aan. De mixbeker, het deksel en de trechter kunnen in de afwasautomaat worden gereinigd. Tip: Na verwerking van vloeistoffen is het meestal voldoende om de mixer te reinigen zonder deze van het apparaat te nemen. Hiervoor doet u 700 ml water met een druppel afwasmiddel in de gemonteerde mixer. Gedurende ca. 1 minuut de mixer inschakelen (stand 7). Afwassop weggieten en de mixer uitspoelen met schoon water. Belangrijke aanwijzing: Zo nodig de opbergzak voor toebehoren reinigen. De aanwijzingen in de opbergzak in acht nemen.

Opbergen W Gevaar voor letsel!

Trek de stekker uit het stopcontact als het apparaat niet wordt gebruikt. Afb. K:

Hulpstukken en fijnmaakschijven opbergen in de opbergzak.

Opbergzak in de kom bewaren.

67

nlHulp bij storingen

Hulp bij storingen W Gevaar voor letsel!

Trek de stekker uit het stopcontact voordat u een storing verhelpt. Belangrijke aanwijzing: Een fout bij de bediening van het apparaat, een activering van de elektronische zekeringen en een apparaatdefect wordt aangegeven door een knipperende functieindicatie. De draaiarm moet in elke bedrijfspositie zijn vastgeklikt. Probeer eerst het probleem te verhelpen aan de hand van de volgende aanwijzingen. Storing Het apparaat start niet. Oplossing

Stroomvoorziening controleren. Netstekker controleren. Draaiarm controleren.

Juiste positie? Vastgeklikt? Mixer/kom tot aan de aanslag

vastdraaien. Mixerdeksel aanbrengen en tot aan de

aanslag vastdraaien. Beschermdeksels aanbrengen op niet

gebruikte aandrijvingen. De beveiliging tegen herinschakeling is

actief. Apparaat op 0/off zetten en dan opnieuw op de gewenste stand zetten.

Storing Het apparaat schakelt uit tijdens het gebruik. De overbelastingsbeveiliging is geactiveerd. Er werden teveel levensmiddelen tegelijk verwerkt. Oplossing

Apparaat uitschakelen. Kleinere hoeveelheid verwerken.

Storing De ontgrendelknop is per ongeluk ingedrukt terwijl de aandrijving liep. De draaiarm beweegt naar boven. De aandrijving scha kelt uit, maar blijft niet op de hulpstukwissel positie staan.

Oplossing Draaischakelaar op 0/Off zetten. Draaiarm op positie 1 zetten. Apparaat inschakelen (stand 1). Apparaat weer uitschakelen.

Het hulpstuk blijft op de hulpstukwissel positie staan. Storing Mixer werkt niet of blijft tijdens het gebruik stilstaan, de aandrijving bromt. Het mes is geblokkeerd. Oplossing

Apparaat uitschakelen en de stekker uit het stopcontact trekken.

Mixer van het apparaat nemen en de belemmering verwijderen.

Mixer weer aanbrengen. Apparaat inschakelen.

Belangrijke aanwijzing Neem contact op met de servicedienst als de storing niet kan worden verholpen.

Toepassingsvoorbeelden Neem de algemene aanbevelingen in de tabellen L, M en N in acht. Toegestane maximumhoeveelheden niet overschrijden.

Biscuitdeeg Basisrecept 2 eieren 23 eetlepels heet water 100 g suiker 1 pakje vanillesuiker 70 g meel 70 g zetmeel, eventueel bakpoeder De ingredinten (behalve het meel en

het aardappelmeel) ca. 4 tot 6 minuten tot schuim kloppen met de klopgarde op stand 7.

De draaischakelaar op stand 1 zetten en het gezeefde meel en aardappelmeel in ca. tot 1 minuut er lepel voor lepel doorroeren.

Maximum hoeveelheid: 2 x basisrecept

68

nl Toepassingsvoorbeelden

Roerdeeg Basisrecept 6 eieren 500 g suiker 1 snufje zout 2 pakjes vanillesuiker of de schil van

citroen 500 g boter of margarine

(op kamertemperatuur) 1.000 g bloem 1 pakje bakpoeder 250 ml melk Eieren, suiker, zout en vanillesuiker of

citroenschil ca. 10 seconden op stand 1 met de roergarde roeren.

Op stand 5 zetten en ca. 120 seconden door elkaar werken.

Boter toevoegen en ca. 60 seconden op stand 3 door elkaar werken.

Bloem en bakpoeder toevoegen en ca. 2 minuten op stand 1 door elkaar werken.

Op stand 3 zetten en binnen 2 minuten geleidelijk de melk toevoegen.

Maximum hoeveelheid: 1 x basisrecept

Zware vruchtencake Basic recipe 3 eieren 135 g suiker 135 g margarine 255 g bloem 10 g bakpoeder 150 g krenten 150 g gemengde gedroogde vruchten Roergarde plaatsen. Alle ingredinten behalve de gedroogde

vruchten erin doen. 30 seconden op stand 1 verwerken. Vervolgens 35 minuten op stand 5

verwerken. Op stand 2 zetten. Binnen 3060 seconden de gedroogde

vruchten erbij doen. Maximale hoeveelheid: 2 x basisrecept

Zandtaartdeeg Basisrecept 125 g boter

(kamertemperatuur) 100125 g suiker 1 ei 1 snufje zout stukje citroenschil of vanillesuiker 250 g meel eventueel bakpoeder Alle ingredinten ca. minuut op

stand 1, dan ca. 36 minuten op stand 3 met de roergarde verwerken.

Vanaf 250 g bloem: De ingredinten ca. minuut kneden

met de kneedhaak op stand 1, daarna ca. 56 minuten op stand 3.

Maximum hoeveelheid: 2 x basisrecept

Gistdeeg Basisrecept 500 g meel 1 ei 80 g vet (kamertemperatuur) 80 g suiker 200250 ml lauwe melk 25 g verse gist of 1 pakje gedroogde

gist schil van citroen 1 snufje zout Alle ingredinten ca. minuut verwer

ken op stand 1, dan ca. 36 minuten op stand 3 verwerken met de kneedhaak.

Maximum hoeveelheid: 2 x basisrecept

Pastadeeg Basisrecept 300 g meel 3 eieren naar wens 12 eetlepels (1020 g) koud

water Alle ingredinten ca. 3 tot 5 minuten op

stand 3 tot deeg kneden. Maximum hoeveelheid: 1,5 x basisrecept

69

nlSpeciale accessoires

Brooddeeg Basisrecept 1000 g meel 2 pakjes gedroogde gist 2 TL zout 600650 ml warm water Alle ingredinten ca. minuut verwer

ken op stand 1, dan ca. 67 minuten op stand 3 verwerken met de kneedhaak.

Mayonaise 1 ei 1 tl mosterd l olie 1 el citroensap of azijn 1 snuifje zout 1 snuifje suiker

Ingredinten moeten kamertemperatuur hebben. Bereiding van mayonaise is alleen met hele eieren mogelijk.

De ingredinten (behalve de olie) enkele seconden mixen op stand 3 of 4.

De mixer op stand 7 zetten en de olie langzaam in de trechter gieten; mengen totdat de mayonaise emulgeert.

De houdbaarheid van de mayonaise is beperkt.

Speciale accessoires Speciale accessoires kunt u bij de service dienst, in de vakhandel of op het internet kopen. Gebruik alleen originele accessoi res, omdat deze precies op uw apparaat zijn afgestemd. Accessoires zijn apparaatgerelateerd. Geef bij de aankoop altijd de precieze aanduiding (ENr.) van uw apparaat op. Welke accessoires beschikbaar zijn voor uw apparaat, kunt u in onze catalogus, in de onlineshop of bij de servicedienst te weten komen. www.bosch-home.com

Afval

J Gooi verpakkingsmateriaal op een milieuvriendelijke manier weg. Dit apparaat is gekenmerkt in overeen- stemming met de Europese richtlijn 2012/19/EU betreffende afgedankte elektrische en elektronische appara- tuur (waste electrical and electronic equipment WEEE). De richtlijn geeft het kader aan voor de in de EU geldige terugneming en verwerking van oude apparaten. Raadpleeg uw gespecialiseerde handelaar voor de geldende voorschriften inzake afvalverwijdering.

Garantie Voor dit apparaat gelden de garantievoor- waarden die worden uitgegeven door de vertegenwoordiging van ons bedrijf in het land van aankoop. De leverancier, bij wie u het apparaat heeft gekocht, geeft u hierover graag meer informatie. Om aanspraak te maken op de garantie heeft u altijd uw aankoopbewijs nodig.

Wijzigingen voorbehouden.

70

da Bestemmelsesmssig brug

Bestemmelsesmssig brug Dette apparat er kun beregnet til anvendelse i private husholdninger og i hjemmet. Brug kun apparatet til forarbejdningsmngder og tider, som er almindelige i husholdningen. Apparatet er egnet til at rre, lte og piske fdevarer. Apparatet m ikke bruges til at forarbejde andre genstande eller substanser. Bruges andre af producenten tilladte tilbehrsdele, er andre anvendelser ogs mulige. Brug kun apparatet med tilladte originale dele og tilbehr. Brug aldrig tilbehrsdelene til andre apparater. Apparatet m kun anvendes indendrs ved stuetemperatur og maks. 2000 m over havets overflade.

Vigtige sikkerhedshenvisninger Ls brugsanvisningen grundigt, flg den, og opbevar den p et sikkert sted! Ved overdragelse af apparatet skal denne vejledning vedlgges. Producenten fraskriver sig ansvaret for skader, der skyldes en manglende overholdelse af instrukserne vedr. korrekt brug af apparatet. Dette apparat kan bruges af personer med reducerede fysiske, sensoriske eller mentale evner eller manglende erfaring og/eller viden, hvis de er under opsyn eller er blevet instrueret i sikker brug af apparatet og har forstet de farer, der kan vre forbundet med brugen af apparatet. Apparatet og tilslutningsledningen skal vre utilgngelige for brn, og de m ikke betjene apparatet. Apparatet er ikke legetj for brn. Rengring og brugervedligeholdelse m ikke foretages af brn.

W Fare for elektrisk std og brandfare! Apparatet m kun tilsluttes og bruges iht. angivelserne p

typeskiltet. Brug kun apparatet, hvis netledningen og apparatet er uden skader. Reparationer p apparatet som f.eks. udskiftning af en beskadiget tilslutningsledning m kun foretages af vores kundeservice for at undg fare.

Apparatet m kun tndes og slukkes med drejekontakten.Tilslut aldrig apparatet til kontakture eller stikdser, der kan fjernbetjenes. Apparatet skal altid vre under opsyn, nr det anvendes!

Apparatet m ikke stilles p eller i nrheden af varme overflader, f.eks. komfur. Netkablet m ikke komme i kontakt med varme dele eller trkkes over skarpe kanter.

Motorenheden m aldrig dyppes ned i vand eller kommes i opvaskemaskine. Anvend ikke nogen damprenser. Brug ikke apparatet med fugtige hnder.

71

daVigtige sikkerhedshenvisninger

Apparatet skal efter hver brug, nr det ikke er under opsyn, altid afbrydes fra strmnettet, fr det samles, adskilles eller rengres og i tilflde af fejl. W Fare for at komme til skade!

Fr udskiftning af tilbehr eller ekstradele, der bevges under driften, skal apparatet slukkes og afbrydes fra strmnettet. Drevet krer stadig lidt kort efter, at apparatet er slukket. Vent, til drevet str helt stille.

Indstil ikke svingarmen, mens apparatet er tndt. Redskaber m kun benyttes, nr sklen er sat i, lget er anbragt og

drevbeskyttelseslgene er sat p! Bruges der tilbehr, s anbring sklen, lget og drevbeskyttelseslgene afhngigt af anvisningen!

Stik aldrig hnderne ned i sklen eller pfyldningsskakten under driften. Fr ikke genstande (f.eks. grydeske) ned i sklen eller pfyldningsskakten. Hold hnder, hr, tj og andre genstande vk fra roterende dele.

Redskaber og tilbehr eller 2 slags tilbehr m aldrig anvendes samtidigt. Overhold bde denne brugsanvisning og de pgldende vedlagte brugsanvisninger i forbindelse med brug af tilbehret.

Tilbehret m kun bruges, nr det er helt samlet. Tilbehret m aldrig samles p motorenheden. Tilbehret m kun bruges i den dertil beregnede arbejdsposition.

Stik ikke fingrene ind i de skarpe knive og kanter p finhaknings skiverne. Tag altid kun fat i kanten p finhakningsskiverne!

Berr ikke blenderknivene med de bare fingre. Stik aldrig fingrene ned i den psatte blender! Brug aldrig

blenderen uden psat lg. Vr forsigtig ved omgangen med de skarpe knive, nr

beholderen tmmes og ved rengringen. W Fare for skoldning!

Ved forarbejdning af varme ingredienser kommer der damp ud gennem tragten i lget.

W Fare for kvlning! Lad ikke brn lege med emballagemateriale.

W OBS! Det anbefales, at apparatet kun er tndt, s lnge fdevarerne forarbejdes. Brug ikke apparatet i tomgang.

W Vigtigt! Rengr altid apparatet grundigt efter hver brug eller efter lngere tid, hvor det ikke har vret i brug (X Rengring og pleje se side 77).

72

da Vigtige sikkerhedshenvisninger

Overbelastningssikring Slukker motoren af sig selv under brug, hvis overbelastningsbeskyttelsen er aktiveret. En mulig rsag kan vre, at for store mngder fdevarer er blevet forarbejdet p en gang. Se under Hjlp i tilflde af fejl, hvad der skal gres, hvis et af sikkerhedssystemerne aktiveres. Apparatet er vedligeholdelsesfrit.

Overblik Billede A: Motorenhed 1 Sikkerhedsknap 2 Svingarm

Easy Armliftfunktion til understttelse af armens bevgelse opad (se Arbejdspositioner).

3 Drejekontakt Efter slukningen (position 0/off) krer maskinen automatisk i den optimale position til udskiftning af redskaberne. 0/off = stop M = momentfunktion med hjeste omdrejningstal, hold kontakten fast for nsket blendetid. Trin 1-7, arbejdshastighed: 1 = lavt omdrejningstal langsom, 7 = hjt omdrejningstal hurtig.

4 Driftsindikator Lyser under driften (drejekontakt p M eller 1-7). Blinker, hvis apparatet betjenes forkert, hvis den elektroniske sikring udlses, eller hvis der opstr en defekt p apparatet, se kapitel Hjlp i tilflde af fejl.

Tillykke med kbet af dit nye apparat fra firmaet Bosch. Flere informationer om vores produkter findes p vores internetside.

Indhold Bestemmelsesmssig brug .....................70 Vigtige sikkerhedshenvisninger ................70 Sikkerhedssystemer .................................72 Overblik ....................................................72 Arbejdspositioner ......................................73 Betjening...................................................74 Rengring og pleje ...................................77 Opbevaring ...............................................78 Hjlp i tilflde af fejl ................................78 Eksempler p brug ..................................79 Ekstratilbehr ...........................................80 Bortskaffelse .............................................80 Reklamationsret........................................80

W Forklaring af symbolerne p apparat hhv. tilbehr

i Flg anvisningerne i brugsvejledningen.

Y Vr forsigtig! Roterende knive.

W Vr forsigtig! Roterende redskaber. Stik ikke fingrene ind i pfyldningsbningen.

Sikkerhedssystemer Indkoblingssikring Se tabel Arbejdspositioner. Apparatet kan kun tndes i position 1 og 3:

hvis sklen (11) er sat i og drejet fast, indtil den falder i hak.

Genindkoblingssikring Ved strmsvigt forbliver apparatet tndt, men motoren gr herefter ikke i gang igen. For at genindkoble apparatet drej da drejekontakten hen p 0/off, og s tnd for det igen.

73

daArbejdspositioner

5 Drevbeskyttelseslg Til aftaging af drevbeskyttelseslget tryk da p det bageste omrde, og tag lget af.

6 Drev til hurtigsnitter og citruspresse (ekstratilbehr*). St drevbeskyttelseslget p, nr drevet ikke er i brug.

7 Drev til redskaber (rreris, piskeris, ltekrog) og kdhakker (ekstratilbehr*)

8 Beskyttelseslg til blenderdrev 9 Drev til blender (ekstratilbehr*)

St beskyttelseslget til blenderdrevet p, nr drevet ikke er i brug.

10 Automatisk ledningsoprul Skl med tilbehr 11 Rreskl af rustfrit stl 12 Lg Redskaber 13 Rreris Profi Flexi 14 Piskeris Profi 15 ltekrog med dejskraber 16 Tilbehrstaske

Til opbevaring af redskaber og finhakningsskiver.

Hurtigsnitter 17 Frugt-/grntsagsstopper 18 Lg med pfyldningsskakt 19 Finhakningsskiver

a Vendeskive Profi Supercut tyk/tynd

b Vendbar raspeskive grov/fin c Riveskive fin d Vendbar skre/raspeskive*

20 Skiveholder 21 Hus med udgangsbning Blender* 22 Blenderbger 23 Lg 24 Tragt * Flger en tilbehrsdel ikke med leveringen, kan den kbes i handlen og hos kundeservice.

Arbejdspositioner Billede B: OBS! Apparatet m kun bruges, hvis redskab/ tilbehr er anbragt p det rigtige drev og i den rigtige position iht. denne tabel og befinder sig i arbejdsstilling. Svingarmen skal vre faldet i hak i enhver arbejdsposition. Bemrk Svingarmen er udstyret med Easy Armliftfunktionen, der understtter svingarmens bevgelse opad.

Indstilling af arbejdsposition: Tryk p sikkerhedsknappen, og bevg

svingarmen. Understt bevgelsen med en hnd.

Bevg svingarmen, indtil den falder i hak i den nskede position.

Position Drev Redskab/ tilbehr

Arbejds- hastighed

1 7

17

15

13

2 7 *

3 6 37

35

4

9 57

7 57

* Istning / udtagning af piskeris, rreris og ltekrog.

74

da Betjening

Betjening W Fare for at komme til skade!

St frst netstikket i, nr alle forberedelser til arbejdet med apparatet er afsluttet. OBS! Apparatet m kun bruges, nr tilbehr/ redskab befinder sig i arbejdsstilling. Brug ikke apparatet, hvis det er tomt. Udst ikke apparat og tilbehrsdele for varmekilder. Delene er ikke egnet til mikroblgeovnen.

Rengr apparat og tilbehr grundigt, fr de tages i brug frste gang, se Rengring og pleje.

Forberedelse Stil motorenheden p et glat og rent

underlag. Trk ledningen i et trk ud i den

nskede lngde (maks. 100 cm), og slip den langsomt. Ledningen er fastlst (Billede C).

Ledningens arbejdslngde reduceres: ved at trkke let i ledningen og rulle den op, indtil den nskede lngde er net. Trk herefter igen let i ledningen, og slip den langsomt. Ledningen er fastlst.

OBS! Hvis ledningen kommer til at sidde i klemme, trk da ledningen helt ud, og rul den s op igen.

St netstikket i.

Skl og redskaber Vr opmrksom p eksemplerne p brug i tabellen. L

W Fare for at komme til skade som flge af roterende redskaber! Stik aldrig fingrene ned i sklen under driften. Arbejd kun med psat lg (12)! Udskift kun redskab, nr drevet str stille drevet krer stadig lidt kort efter, at apparatet er slukket, og bliver stende i redskabsskiftepositionen. Bevg frst svingarmen, nr redskabet str stille. Tildk altid ikke anvendte drev med drevbeskyttelseslgene.

OBS! Brug kun sklen til arbejde med dette apparat. Rreris Profi Flexi (13) til at rre dej, f.eks. kagedej, frugt kagedej osv. og til at iblande ingre dienser ssom rosiner og chokoladestykker Piskeris Profi (14) til at piske ggehvider og flde (fedtindhold p mindst 30 %) og til at blande lagkagedej ltekrog (15) til at lte dej, f.eks. grdej, brddej, pizzadej, pastadej, smka gedej og til at iblande ingredienser ssom fr i dejen Vigtig henvisning mht. brug af piskeris (Billede D): Piskeriset skal nsten berre sklens bund, for at ingredienserne blandes godt. Hvis dette ikke er tilfldet, indstilles piskeriset i hjden p flgende mde:

Trk netstikket ud. Tryk p sikkerhedsknappen, og

stil svingarmen i position 2. St piskeriset i drevet, indtil det

falder i hak. Hold fast i piskeriset, og lsn mtrikken

i retning med uret vha. gaffelnglen (SW 8).

Indstil piskeriset i den optimale hjde ved at dreje riset: Drej i retning med uret: Lft. Drej i retning mod uret: Snk

Tryk p sikkerhedsknappen, og stil svingarmen i position 1.

Kontrollr piskerisets hjde, og korrigr den efter behov.

Nr hjden er indstillet rigtigt, tryk da p sikkerhedsknappen, og stil svingarmen i position 2.

Hold fast i piskeriset, og spnd mtrikken i retning mod uret vha. gaffelnglen (SW 8).

75

daBetjening

Arbejde med skl og redskaber (Billede E):

Tryk p sikkerhedsknappen, og stil svingarmen i position 2.

St sklen i: Vip sklen fremad, og st den p plads. Drej den i retning mod uret, indtil den falder i hak.

Alt efter forarbejdningsopgave st da rreriset, piskeriset eller ltekrogen i drevet, indtil de falder i hak.

Bemrk: Ved ltekrogen drejes dejskraberen, indtil ltekrogen kan falde i hak (Billede E-4b).

Kom ingredienserne, der skal forarbej des, i sklen.

Tryk p sikkerhedsknappen, og stil svingarmen i position 1.

St lget p. Stil drejekontakten p det

nskede trin. Pfyldning af flere ingredienser

Sluk for apparatet med drejekontakten. Pfyld ingredienserne gennem

pfyldningsbningen i lget. eller

Tag lget af. Tryk p sikkerhedsknappen,

og stil svingarmen i position 2. Pfyld ingredienserne.

Efter brug Sluk for apparatet med drejekontakten. Trk netstikket ud. Tag lget af. Tryk p sikkerhedsknappen, og

stil svingarmen i position 2. Tag redskabet ud af drevet. Tag sklen ud. Rengr alle dele, se Rengring og

pleje.

Hurtigsnitter Vr opmrksom p eksemplerne p brug i tabellen. M

W Fare for tilskadekomst! Stik ikke fingrene ind i de skarpe knive og kanter p finhakningsskiverne. Tag altid kun fat i kanten p finhakningsskiverne!

Hurtigsnitteren m kun sttes p/tages af, nr drevet str stille, og netstikket er trukket ud. Stik ikke fingrene ind i pfyldningsskakten. OBS! Hurtigsnitteren m kun benyttes, nr den er helt samlet. Forsg aldrig at samle hurtig snitteren p motorenheden. Hurtigsnitteren m kun bruges i den angivne driftsposition. Beskyttelse mod overbelastning Billede F: Hurtigsnitterens drivaksel har et hak (fast brudsted), som modvirker strre skader p dit apparat, hvis hurtigsnitteren overbelastes. Drivakslen brkker p dette sted i tilflde af overbelastning. En ny skiveholder med drivaksel kan kbes hos kundeservice. Vendeskive Profi Supercut tyk/tynd Til skring af frugt og grnt. Forarbejdning p trin 5. Betegnelse p vendeskreskiven: Grob (grov) for den tykke skreside Fein (fin) for den tynde skreside OBS! Vendeskreskiven er ikke egnet til at skre hrd ost, brd, rundstykker og chokolade. Kogte fastkogende kartofler skal altid vre kolde, fr de skres. Vendbar raspeskive grov/fin til at raspe fdevarer i grove eller fine stykker, f.eks. frugt, grntsager eller ost ssom gouda eller edamer. Mrkning

2 = grov side 4 = fin side

Bemrk: Ikke egnet til at forarbejde ndder eller hrd ost, f.eks. parmesan. Tip: Rasp bld ost med den grove side. Riveskive fin til at raspe fdevarer fint, f.eks. ndder eller hrd ost ssom parmesan. Bemrk: Ikke egnet til at forarbejde bld ost og skreost. Vendbar skre-/raspeskive til at rive r kartofler eller til at skre dem i skiver.

76

da Betjening

Bemrk: Ikke egnet til at forarbejde meget fiberholdige fdevarer, f.eks. porre eller mango. Arbejde med hurtigsnitteren Billede G:

Tryk p sikkerhedsknappen, og stil svingarmen i position 2.

St sklen i: Vip sklen fremad, og st den p plads. Drej den i retning mod uret, indtil den falder i hak.

Tryk p sikkerhedsknappen, og stil svingarmen i position 3.

Tag drevbeskyttelseslget af drevet til hurtigsnitteren (Billede G-5a).

Hold fast i nederste ende p skiveholderen, her skal de to spidser pege opad.

Anbring den nskede skre eller riveskive forsigtigt p spidserne af skiveholderen (Billede G-6a). Hvis der benyttes en vendeskive, skal man vre opmrksom p, om den nskede side peger opad.

Tag fat i den verste ende p skiveholderen, og st den ind i huset (Billede G-6b).

St lget p (hold je med markerin gen), og drej det i retning med uret indtil stop.

St hurtigsnitteren p drevet, og drej den i retning med uret indtil stop som vist p billede G-8.

Stil drejekontakten p det anbefalede trin.

Kom fdevarerne, der skal forarbejdes, i pfyldningsskakten, og skub dem ned med stopperen.

OBS! Undg tilstopning af det, som skres, i udgangsbningen. Tip: Forarbejd tynde fdevarer i bundter, det giver et mere ensartet snit.

Bemrk: Hvis fdevarerne, der skal forarbejdes, klemmer sig fast i hurtigsnitteren, s sluk for kkkenmaskinen, trk netstikket ud, vent til drevet str stille, tag lget af hurtigsnitteren, og tm pfyldningsskakten. Efter brug

Sluk for apparatet med drejekontakten. Drej hurtigsnitteren i retning mod uret,

og tag den af. Drej lget i retning mod uret, og tag det

af. Tag skiveholder med skive ud. Tryk

hertil fingeren mod drivakslen nedefra (Billede H).

Rengr delene.

Blender Vr opmrksom p eksemplerne p brug i tabellen. N

W For for at komme til skade som flge af skarpe knive/roterende drev! Stik aldrig fingrene ned i den psatte blender! Blenderen m kun tages af/sttes p, nr drevet str stille! Blenderen m kun anvendes, nr den er samlet, og lget er sat p. Brug ikke blenderen, hvis den er tom.

W Fare for skoldning! Ved forarbejdning af varme ingredienser kommer der damp ud gennem tragten i lget. Arbejde med blenderen Billede J:

Tryk p sikkerhedsknappen, og stil svingarmen i position 4.

Tag beskyttelseslget til blenderdrevet af.

St blenderbgeret p (markering p grebet skal vre ud for markering p motorenheden), og drej det i retning mod uret indtil stop.

Pfyld ingredienserne. Maks. mngde, flydende konsistens = 1,25 liter; maks. mngde skummende eller varme vsker = 0,75 liter.

77

daRengring og pleje

St lget p, og drej det i retning mod uret ind i blendergrebet indtil stop. Lget skal vre faldet i hak.

Stil drejekontakten p det nskede trin. Pfyldning af flere ingredienser Billede J-8:

Sluk for apparatet med drejekontakten. Tag lget af, og pfyld ingredienserne

eller fjern tragten, og pfyld faste

ingredienserne lidt ad gangen i pfyldningsbningen

eller pfyld flydende ingredienser gennem

tragten. Efter brug

Sluk for apparatet med drejekontakten. Drej blenderen i retning med uret, og tag

den af. Tip: Det anbefales at rengre blenderen straks efter brug.

W OBS! Uegnede fdevarer kan beskadige apparatet.

Forarbejd ikke varme fdevarer p over 70 C i blenderbgeret.

Forarbejd ikke dybfrosne fdevarer, undtagen isterninger, nr de er kommet i en tilstrkkelig mngde vske.

Forarbejd ikke fdevarer, som indeholder hrde bestanddele. Fr forarbejdningen af kerne og stenfrugt (bler, ferskner osv.) skal kernerne eller stenene fjernes.

Henvisninger Begrnsninger for forarbejdningen:

Ingredienser ssom mandler, lg, per sille eller kd m ikke hakkes.

Blenderen kan ikke bruges til fremstilling af smreplg ssom jordnddesmr, kokossmr eller nddemos.

Bland faste fdevarer med tilstrkkelig meget vske.

Bland fdevarer i pulverform med tilstrkkelig meget vske, eller opls dem fuldstndigt i vske, fr de blendes. Fdevarer i pulverform er f.eks. flormelis, kakaopulver, ristede sojabnner, mel, proteinpulver.

Rengring og pleje De anvendte tilbehrsdele skal rengres grundigt efter hver brug. X Tabel O OBS! Brug ikke skurende rengringsmidler. Overfladerne kan beskadiges.

Rengring af motorenhed W Fare for elektrisk std!

Dyp aldrig motorenheden i vand, og hold den aldrig ind under rindende vand. Brug ikke nogen damprenser.

Trk netstikket ud. Tr motorenhed og drevbeskyttelseslg

af med en fugtig klud. Brug lidt opvaskemiddel efter behov.

Tr apparatet af med en tr klud.

Rengring af skl og redskab Skl og redskaber kan tle opvaskemaskine. Kunststofdele m ikke klemmes fast i opvaskemaskinen, da de kan blive varigt deformeret under opvasken!

Rengring af hurtigsnitter W Fare for at komme til skade p grund af skarpe knive!

Stik ikke fingrene ind i de skarpe knive og kanter p finhakningsskiverne. Benyt en brste til rengring. Alle dele p hurtigsnitteren kan tle opvaskemaskine. Tip: Til at fjerne den rde belgning efter forarbejdning af f.eks. gulerdder kom da en smule spiseolie p en klud, og gnid med den hen over hurtigsnitteren (ikke over finhakningsskiverne). Vask herefter hurtigsnitteren.

78

da Opbevaring

Rengring af blender W Fare for at komme til skade p grund

af skarpe knive! Berr ikke blenderknivene med de bare hnder. Blenderbger, lg og tragt kan tle opvaskemaskine. Tip: Efter forarbejdning af vsker behver man normalt ikke at tage blenderen af apparatet til rengring. Kom hertil 700 ml vand med en drbe opvaskemiddel i den psatte blender. Tnd for blenderen, og lad den kre i ca. 1 minut (trin 7). Hld opvaskevandet ud, og skyl blenderen med rent vand. Vigtig henvisning: Rengr tilbehrstasken efter behov. Flg plejehenvisningerne i tasken.

Opbevaring W Fare for at komme til skade!

Trk netstikket ud, nr apparatet ikke er i brug. Billede K:

Opbevar redskaber og finhakningsskiver i tilbehrstasken.

Opbevar tilbehrstasken i sklen.

Hjlp i tilflde af fejl W Fare for at komme til skade!

Trk netstikket ud, fr du afhjlper en fejl. Vigtig henvisning: Forkert betjening af apparatet, en udlsning af de elektroniske sikringer eller en defekt p apparatet vises med en blinkende driftsindikator. Svingarmen skal vre faldet i hak i enhver arbejdsposition. Forsg frst at afhjlpe det opstede problem ved hjlp af efterflgende henvisninger. Fejl Apparatet starter ikke. Afhjlpning

Kontrollr strmforsyningen.

Kontrollr netstikket. Kontrollr svingarmen.

Rigtig position? Faldet i hak? Drej blenderen eller sklen fast indtil

stop. St blenderlget p, og drej det fast

indtil stop. St drevbeskyttelseslg p de drev, der

ikke er i brug. Genindkoblingssikringen er aktiv. Stil

frst apparatet p 0/off og herefter tilbage p det nskede trin.

Fejl Apparatet slukker under brug. Overbelastningssikringen er aktiveret. Der er blevet forarbejdet for mange fdevarer p en gang. Afhjlpning

Sluk for apparatet. Reducr forarbejdningsmngden.

Fejl Sikkerhedsknappen blev ved en fejltagelse betjent, mens drevet var i gang. Svingarmen bevger sig opad. Drevet slukker, men bliver ikke stende i redskabsskiftepositionen. Afhjlpning

Stil drejekontakten p 0/off. Stil svingarmen i position 1. Tnd for apparatet (trin 1). Sluk for apparatet igen.

Redskabet bliver stende i redskabsskiftepositionen. Fejl Blenderen starter ikke eller bliver stende under brug, drevet brummer. Kniven er blokeret. Afhjlpning

Sluk for apparatet, og trk netstikket ud.

Tag blenderen af, og fjern hindringen. St blenderen p igen. Tnd for apparatet.

Vigtig henvisning Kan fejlen ikke afhjlpes p denne mde, s kontakt kundeservice.

79

daEksempler p brug

Eksempler p brug Flg de generelle anbefalinger i tabel lerne L, M og N. Overskrid ikke tilladte maks. mngder.

Lagkagedej Grundopskrift 2 g 23 spsk varmt vand 100 g sukker 1 pakker vanillesukker 70 g mel 70 g maizenamel evt. bagepulver Rr ingredienserne (undtagen mel og

maizenamel) sammen i ca. 46 minutter p trin 7 med piskeriset, til det skummer.

Stil drejekontakt p trin 1 og tilst det sigtede mel og maizenamel skevis i

lbet af et halvt til et minut. Maks. mngde: 2 gange grundopskrift

Rrt dej Grundopskrift 6 g 500 g sukker 1 knivspids salt 2 breve vaniljesukker

eller skal af en citron 500 g smr eller magarine

(stuetemperatur) 1000 g mel 1 brev bagepulver 250 ml mlk Rr g, sukker, salt og vaniljesukker

eller citronskal sammen i ca. 10 sekun der med piskeriset p trin 1.

Indstil p trin 5, og forarbejd blandingen i ca. 120 sekunder.

Tilst smr, og forarbejd i ca. 60 sekunder p trin 3.

Tilst mel og bagepulver, og forarbejd i ca. 2 minutter p trin 1.

Indstil p trin 3, og tilst mlken lidt ad gangen inden for 2 minutter.

Maks. mngde: 1 x grundopskrift

Rig frugtkage Grundopskrift 3 g 135 g sukker 135 g margarine 255 g mel 10 g bagepulver 150 g korender 150 g blandede trrede frugter St rreriset i. Fyld alle ingredienserne i, bortset fra de

trrede frugter. Forarbejd i 30 sekunder p trin 1. Forarbejd herefter i 35 minutter p

trin 5. Indstil p trin 2. Tilst de trrede frugter inden for

3060 sekunder. Maks. mngde: 2 x grundopskrift

Mrdej Grundopskrift 125 g smr

(stuetemperatur) 100125 g sukker 1 g 1 knivspids salt en smule citronskal eller vanillesukker 250 g mel evt. bagepulver Forarbejd alle ingredienserne i ca.

minut p trin 1, herefter i ca. 36 minut ter p trin 3 med rreriset.

Fra 250 g mel: Rr alle ingredienserne i ca. et halvt

minut p trin 1 med ltekrogen, herefter dejen ltes i ca. 56 minutter p trin 3.

Maks. mngde: 2 gange grundopskrift

Grdej Grundopskrift 500 g mel 1 g 80 g fedt (rumtemperatur) 80 g sukker 200250 ml lunken mlk 25 g frisk gr eller 1 pakke trgr skal af citron 1 knivspids salt

80

da Ekstratilbehr

Rr alle ingredienserne i ca. et halvt minut p trin 1, herefter i ca. 36 minut ter p trin 3 med ltekrogen.

Maks. mngde: 2 gange grundopskrift

Nudeldej Grundopskrift 300 g mel 3 g Efter behov 12 spsk. (1020 g)

koldt vand Alle ingredienser rres til en dej i ca. 3

til 5 minutter p trin 3. Maks. mngde: 1,5 gange grundopskrift

Brddej Grundopskrift 1000 g mel 2 pakker trgr 2 tsk salt 600650 ml varmt vand Rr alle ingredienserne i ca. et halvt

minut p trin 1, herefter i ca. 67 minut ter p trin 3 med ltekrogen.

Mayonnaise 1 g 1 tsk. sennep l olie 1 spsk. citronsaft eller eddike 1 knsp. salt 1 knsp. sukker

Ingredienserne skal have stuetemperatur. Det er kun muligt at tilberede mayonnaise med hele g.

g, sennep, citronsaft, salt og sukker kommes i blenderen og blandes i nogle sekunder p trin 3 eller 4.

Stil blenderen p trin 7. Hld langsomt olie gennem hullet i lget og bliv ved med at blande mayonnaisen, til den har fet en fast konsistens.

Mayonnaise skal bruges i lbet af kort tid og ikke opbevares.

Ekstratilbehr Ekstratilbehr kan kbes hos kundeservice, hos forhandleren eller p Internettet. Anvend kun originalt tilbehr, fordi det er fuldstndig tilpasset til det aktuelle apparat. Tilbehr er specifikt for det enkelte apparat. Angiv altid den njagtige betegnelse (ENr.) for apparatet ved kb af ekstratilbehr. Det tilgngelige tilbehr til det aktuelle apparat kan ses i vores katalog, i onlines hoppen eller hos kundeservice. www.bosch-home.com

Bortskaffelse

J Emballagen skal bortskaffes p miljvenlig vis. Dette apparat er klas- sificeret iht. det europiske direktiv 2012/19/EU om affald af elektrisk- og elektronisk udstyr (waste electrical and electronic equipment WEEE). Dette direktiv angiver rammerne for indlevering og recycling af kasserede apparater gldende for hele EU. Du kan f nrmere informationer om aktuelle muligheder for bortskaffelse i faghandlen.

Reklamationsret P dette apparat yder Bosch 2 rs rekla- mationsret. Kbsnota skal altid vedlgges ved indsendelse til reparation, hvis denne nskes udfrt indenfor retten til reklamation. Medflger kbsnota ikke, vil reparationen altid blive udfrt mod beregning.

Indsendelse til reparation Skulle Deres Bosch apparat g i stykker, kan det indsendes til vort servicevrksted: BSH Hvidevarer A/S, Telegrafvej 4, 2750 Ballerup, tlf. 44 89 88 10.

Ret til ndringer forbeholdes.

81

noKorrekt bruk

Korrekt bruk Dette apparatet er bare ment for bruk i private husholdninger. Apparatet m kun brukes til bearbeide vanlige husholdningsmengder og ogs innen vanlige bearbeidelsestider. Apparatet er egnet til rring, elting og pisking av matvarer. Apparatet m ikke brukes til bearbeidelse av andre gjenstander eller substanser. Ved bruk av andre tilbehrsdeler som er godkjent av produsenten, er det ogs mulig med annen bruk i tillegg. Apparatet skal kun brukes med godkjente originaldeler og tilbehr. Tilbehrsdelene m aldri brukes for andre apparater. Apparatet skal kun brukes innendrs ved romtemperatur, og ikke hyere enn 2000 meter over havet.

Viktige sikkerhetsanvisninger Les nye igjennom bruksanvisningen og rett deg etter den. Den m oppbevares omhyggelig! Dersom apparatet blir levert videre, m denne veiledningen vedlegges. Dersom det ikke blir tatt hensyn til henvisningene for riktig bruk av apparatet, er produsenten ikke ansvarlig for skader som oppstr p grunn av dette. Dette apparatet kan brukes av personer med reduserte fysiske, sensoriske eller mentale evner eller mangel p erfaring og/eller kunnskap dersom de er under oppsyn eller har ftt opplring i sikker bruk av apparatet og er informert om farene ved bruk av apparatet. Barn m holdes borte fra apparatet og tilkoplingslednin gen. De m ikke f lov betjene apparatet. Barn m ikke leke med apparatet. Rengjring og brukervedlikehold m ikke utfres av barn.

W Fare for elektrisk stt og brannfare Apparatet m kun tilkobles og brukes i henhold til angivelsene p

typeskiltet. M kun benyttes nr ledningen og apparatet ikke viser tegn p skade. Reparasjoner p apparatet, f.eks. utskifting av skadet tilkoblingsledning, m kun foretas av vr kundeservice, for unng at det oppstr farer.

Apparatet m kun sls p og av med dreiebryteren. Dette apparatet m aldri kobles til tidsur eller stikkontakter med

fjernkontroll. Hold alltid tilsyn med apparatet nr det er i bruk! Apparatet m ikke settes p eller i nrheter av varme overflater,

f.eks. komfyren. La aldri strmkabelen komme i berring med varme deler, og trekk den aldri over skarpe kanter.

Basisapparatet m aldri dyppes ned i vann eller vaskes i oppvaskmaskin. Ikke bruk damprenser. Apparatet m ikke brukes med fuktige hender.

82

no Viktige sikkerhetsanvisninger

Apparatet m alltid kobles fra nettet etter bruk, nr det ikke er under tilsyn, fr det settes sammen, tas fra hverandre eller rengjres og ved feil. W Fare for skade!

Apparatet m sls av og kobles fra nettet, fr det skiftes tilbehrsdeler eller ekstrautstyr som beveges under bruk. Etter at apparatet er sltt av, fortsetter drevet g en kort tid. Det m ventes til drevet str helt stille.

Svingarmen m ikke flyttes p nr apparatet er sltt p. Verktyet m bare brukes med innsatt bolle, psatt lokk

og beskyttelseslokk satt p drevet! Sett p bolle, lokk og beskyttelseslokk for drev iht. instruksjonene ved bruk av tilbehr!

Under bruk m du aldri gripe ned i bollen eller pfyllingssjakten med hendene. Fr ikke gjenstander (f.eks. sleiv) ned i bollen eller pfyllingssjakten. Hold hender, hr, klr og andre gjenstander p avstand fra roterende deler.

Det m aldri brukes verkty og tilbehr eller 2 tilbehr samtidig. Ved bruk av tilbehret, m denne og de andre vedlagte bruksanvisningene flges.

Tilbehret m kun brukes i komplett sammensatt tilstand. Tilbehret m aldri settes sammen p basisapparatet. Tilbehret m kun brukes i hertil tiltenkt arbeidsstilling.

Det m ikke gripes i de skarpe knivene og kantene p kutteskivene. Kutteskivene m kun tas i langs kanten!

Mikserkniven m ikke berres med bare hender. Grip aldri inn i den psatte mikseren! Mikseren m aldri brukes

uten psatt lokk. Vr forsiktig nr du hndterer de skarpe knivene, nr du tmmer

beholderen og under rengjring. W Fare for skolding!

Ved bearbeiding av varme mikseprodukter, kommer det damp ut av trakten i lokket.

W Fare for kvelning! Barn m ikke f leke med emballasjen.

W Obs! Det anbefales ikke la maskinen vre innkoblet lenger enn det som er ndvendig for bearbeidingen av matvarene. M ikke brukes p tomgang.

W Viktig! Det er tvingende ndvendig rengjre apparatet grundig etter hver bruk eller nr det ikke har vrt i bruk i en lengre periode (X Rengjring og pleie se side 88).

83

noViktige sikkerhetsanvisninger

Overlastvern Hvis motoren sls av av seg selv under bruk, er overlastvernet aktivert. En mulig rsak kan vre en samtidig bearbeidelse av for store mengder matvarer. Hvordan du gr fram dersom et av sikkerhetssystemene er aktivert, se Hjelp ved feil. Apparatet er vedlikeholdsfritt.

En oversikt Bilde A: Basismaskin 1 Utlsningstast 2 Svingkarm

Easy Armliftfunksjon for understttelse av armens bevegelse oppover (se Arbeidsposisjoner).

3 Dreiebryter Etter utkoblingen (stilling 0/off) gr apparatet automatisk i den optimale posisjonen for skift av verkty. 0/off = Stopp M = Momentkobling med hyeste turtall, bryteren holdes fast for nsket miksetid. Trinn 1-7, arbeidshastighet: 1 = lavt turtall sakte, 7 = hyt turtall hurtig.

4 Driftsindikator Lyser under drift (dreiebryter p M eller 1-7). Blinker dersom det er gjort feil ved betjeningen av apparatet, dersom den elektroniske sikringen er utlst hhv. ved en defekt p apparatet, se kapittel Hjelp ved feil.

Gratulerer med ditt nye Bosch-produkt. Mer informasjon om vre produkter finner du p vr internettside.

Innhold Korrekt bruk ..............................................81 Viktige sikkerhetsanvisninger ...................81 Sikkerhetssystemer ..................................83 En oversikt ................................................83 Arbeidsposisjoner .....................................84 Betjening...................................................85 Rengjring og pleie ..................................88 Oppbevaring .............................................89 Hjelp ved feil .............................................89 Eksempler p bruk ...................................90 Spesialtilbehr ..........................................91 Avfallshndtering ......................................91 Garanti ......................................................91

W Forklaringer av symbolene p apparatet hhv. tilbehret

i Anvisninger i bruksveiledningen m flges.

Y Vr forsiktig! Roterende kniver.

W Vr forsiktig! Roterende verkty. Det m ikke gripes inn i pfyllingspningen.

Sikkerhetssystemer Innkoblingssikring Se tabell Arbeidsposisjoner. Apparatet lar seg kun sl p i posisjon 1 og 3:

nr bollen (11) er satt inn og dreiet til den har smekket i ls.

Sikring mot gjeninnkobling Ved strmbrudd forblir apparatet innkoblet, men motoren starter ikke igjen nr strmmen kommer tilbake. For sl apparatet p igjen m du vri dreiebryteren p 0/off og deretter sl den p.

84

no Arbeidsposisjoner

5 Beskyttelseslokk for drev For ta beskyttelseslokket av drevet, m du trykke p det bakre omrdet og ta av lokket.

6 Drev for gjennomlpskutter og sitruspresse (spesialtilbehr*). Nr det ikke brukes m beskyttelseslokket settes p drevet.

7 Drev for verkty (rrepinne, visp, eltekrok) og kjttkvern (spesialtilbehr*)

8 Beskyttelseslokk for mikserdrevet 9 Beskyttelseslokk for mikserdrevet

(spesialtilbehr*) Nr det ikke er i bruk, m beskyttelseslokket settes p mikserdrevet.

10 Kabelopprullingsautomatikk Bolle med tilbehr 11 Rrebolle i rustfritt stl 12 Lokk Verkty 13 Visp Profi Flexi 14 Profi-visp 15 Eltekrok med deigskrape 16 Tilbehrsveske

For oppbevaring av verkty og kutteskiver.

Gjennomlpskutter 17 Stter 18 Lokk med pfyllingssjakt 19 Kutteskiver

a Vendeskive Profi Supercut tykk / tynn

b Raspevendeskive grov/fin c Riveskive fin d Skjre/raspevendeskive*

20 Skiveholder 21 Hus med utlpspning Mikser* 22 Miksebeger 23 Lokk 24 Trakt * Dersom en av tilbehrsdelene ikke er med i leveringsomfanget, kan den fes i handelen og hos kundeservice.

Arbeidsposisjoner Bilde B: Obs! Apparatet m kun brukes nr verktyet/ tilbehret er satt p det riktige drevet i henhold til denne tabellen og satt i riktig posisjon og er i arbeidsstilling. Svingarmen m vre smekket i ls i hver av arbeidsposisjonene. Henvisning Svingarmen er utstyrt med Easy Armliftfunksjon som understtter svingarmens bevegelse oppover.

Innstilling av arbeidsposisjonen: Trykk p utlsningstasten og beveg

sving armen. Sttt bevegelsen med en hnd.

Beveg svingarmen til nsket posisjon til den smekker i ls.

Posisjon Drev Verkty/ tilbehr/

Arbeids- hastighet

1 7

17

15

13

2 7 *

3 6 37

35

4

9 57

7 57

85

noBetjening

* Innsetting/uttaking av visp, rrepinne og eltekrok.

Betjening W Fare for skade!

Stpselet m frst kobles til nr alle forberedelsene til arbeidet med maskinen er avsluttet. Obs! Apparatet m kun drives med tilbehr / verkty i arbeidsstilling. Apparatet m ikke brukes nr det er tomt. Apparatet og tilbe hrsdelene m ikke utsettes for varmekilder. Delene er ikke egnet for mikroblgeovn.

Apparatet og tilbehret m rengjres grundig fr frste gangs bruk, se Rengjring og pleie.

Forberedelser Plasser basismaskinen p et glatt og

rent underlag. Trekk ut kabelen med ett trekk inntil

nsket lengde (maks 100 cm) og slipp den langsomt igjen. Kabelen er n sikret (bilde C).

Nr kabelen skal ha mindre arbeidslengde: Trekk lett i kabelen og la den rulle opp til nsket lengde. Deretter trekkes det lett i kabelen igjen og slippes langsomt; kabelen er sikret.

Obs! Dersom kabelen klemmes fast, m du trekke kabelen helt ut og deretter rulle den opp igjen.

Sett i stpselet.

Bolle og verkty Ta hensyn til eksemplene p bruk i tabellen. L

W Fare for skade p grunn av roterende verkty! Under driften m det aldri gripes inn i bollen. Det m kun arbeides med psatt lokk (12)! Verktyet m kun skiftes nr drevet str stille etter utkoblingen fortsetter drevet g i kort tid og blir stende i posisjonen for skift av verkty.

Svingarmen m frst beveges etter at verktyet str stille. Drev som ikke blir brukt, m alltid dekkes til med beskyttelseslokk for drev. Obs! Bollen m kun brukes for arbeider med dette apparatet. Visp Profi Flexi (13) til rring av deig, f.eks. kakedeig, fruktkake, osv., og til skjre inn ingredienser som rosiner og sjokoladebiter Profi visp (14) til pisking av eggehvite og krem flte (minst 30 % fett), og til blan ding av sukkerbrdrre Eltekrok (15) til elting av deig, f.eks. gjrdeig, brddeig, pizzadeig, pastadeig, smkakedeig, og til skjre inn ingredien ser som fr i deigen Viktig henvisning om bruk av vispen (Bilde D): Vispen br nesten berre bunnen p bollen, for blande ingrediensene best mulig. Dersom ikke, kan hydeinnstillingen til vispen innstilles som flger:

Trekk ut stpselet. Trykk p utlsningstasten og

sett svingarmen i posisjon 2. Stikk vispen inn i drevet til den

smekker i ls. Hold vispen fast og lsne mutteren med

urviseren med fastnkkel (SW 8). Hyden p vispen kan s innstilles ved

dreie vispen til optimal hyde: Dreies med urviseren: lftes Dreies mot urviseren: senkes

Trykk p utlsningstasten og sett svingarmen i posisjon 1.

Kontroller hyden p vispen, juster om ndvendig.

Nr hyden er riktig innstilt, trykkes utlsningstasten og svingarmen settes i posisjon 2.

Hold fast vispen og skru mutte ren fast mot urviseren med fastnkkel (SW 8).

86

no Betjening

Arbeider med bollen og verkty (Bilde E):

Trykk p utlsningstasten og sett svingarmen i posisjon 2.

Innsetting av bollen: Hold bollen p skr framover og sett den p, plasser den og drei den mot urviseren til den smekker i ls.

Alt etter arbeidsoppgave, stikkes rrepinnen, vispen eller eltekroken inn i drevet til de smekker i ls.

Henvisning: Ved bruk av eltekroken dreies deigskrapen til eltekroken kan smekke i ls (bilde E4b).

Fyll ingrediensene som skal bearbeides p bollen.

Trykk p utlsningstasten og sett svingarmen i posisjon 1.

Lokket settes p. Sett dreiebryteren p nsket

trinn. Pfylling av ingredienser

Sl av apparatet med dreiebryteren. Fyll p ingrediensene gjennom

pfyllingspningen i lokket. eller

Ta av lokket. Trykk p utlsningstasten og

sett svingarmen i posisjon 2. Fyll p ingredienser.

Etter arbeidet Sl av apparatet med dreiebryteren. Trekk ut stpselet. Ta av lokket. Trykk p utlsningstasten og

sett svingarmen i posisjon 2. Ta verktyet ut av drevet. Ta ut bollen. Rengjr alle delene, se Rengjring og

pleie.

Gjennomlpskutter Ta hensyn til eksemplene p bruk i tabellen. M

W Fare for personskader! Ikke grip tak i de skarpe knivene og kantene p kutteskivene.

Grip kun tak i kanten av kutteskivene! Gjennomlpskutteren m kun settes p/tas av nr drevet str stille, og nr stpselet er trukket ut. Grip ikke ned i pfyllingssjakten. Obs! Gjennomlpskutteren m kun brukes i komplett sammensatt tilstand. Gjennomlpskutteren m aldri settes sammen p basismaskinen. Gjennomlpskutteren m kun brukes i den oppfrte arbeidsposisjonen. Beskyttelse mot overbelastning Bilde F: For forhindre strre skader p apparatet ditt, dersom gjennomlpskutteren blir overbelastet, er drivakslingen p gjennomlpskutteren utstyrt med en kjerv (fastlagt bruddsted). Ved overbelastning brekkes drivakslingen p dette stedet. En ny skiveholder med drivaksling fes hos kundeservice. Vendeskive Profi Supercut tykk / tynn til skjring av matvarer i tykke eller tynne skiver, f.eks. frukt og grnnsaker. Merking:

Grov = tykke skiver Fin = tynne skiver

Merk: Ikke egnet til bearbeidning av hard ost, brd, rundstykker eller sjokolade. Tips: Vent med skjre kokte poteter til de er blitt kalde. Raspevendeskive grov/fin til rasping av matvarer i grove eller fine biter, f.eks. frukt, grnnsaker eller ost, som gouda eller edamer. Merking:

2 = grov side 4 = fin side

Merk: Ikke egnet til bearbeidning av ntter eller hard ost, f.eks. parmesanost. Tips: Rasp myk ost med den grove siden.

87

noBetjening

Riveskive fin til fin rasping av matvarer, f.eks. ntter eller hard ost, f.eks. parmesanost. Merk: Ikke egnet til bearbeidning av myk ost og ost i skiver. Skjre-/raspe-vendeskive til rive eller skjre i skiver r poteter. Merk: Ikke egnet til bearbeidning av matva rer med mye fiber, f.eks. purre eller mango. Arbeide med gjennomlpskutteren Bilde G:

Trykk p utlsningstasten og sett svingarmen i posisjon 2.

Innsetting av bollen: Hold bollen p skr framover og sett den p, plasser den og drei den mot urviseren til den smekker i ls.

Trykk utlsningstasten og sett svingarmen i posisjon 3.

Ta av beskyttelseslokket p drevet p gjennomlpskutteren (bilde G-5a).

Hold skiveholderen fast i nederste enden. Begge spissene m da peke oppover.

Den nskede skjre eller raspeskiven legges forsiktig p skiveholderens spisser (bilde G-6a). Ved bruk av vendeskiver m det passes p at den nskede siden peker oppover.

Hold skiveholderen i den vre enden og sett den inn i huset (bilde G-6b).

Lokket settes p (ta hensyn til markerin gen) og dreies til stopp med urviseren.

Sett gjennomlpskutteren p drevet, som vist p bilde G-8, og drei den til stopp med urviseren.

Sett dreiebryteren p anbefalt trinn. Fyll de matvarene som skal bearbeides

p pfyllingssjakten og skyv dem ned med stteren.

Obs! Det m unngs at skjregodset hoper seg opp i utlpspningen. Tips: For jevne skjreresultater m tynt skjregods bearbeides i bunter.

Henvisning: Dersom matvarene som skal bearbeides blir klemt fast i gjennomlpskutteren, m du sl av kjkkenmaskinen, trekke ut stpselet, vente til drevet str stille, ta lokket av og tmme pfyllingssjakten. Etter arbeidet

Sl av apparatet med dreiebryteren. Drei gjennomlpskutteren mot urviseren

og ta av den. Drei lokket mot urviseren og ta det av. Ta av skiveholderen med skiven. Trykk

da med fingeren nedenfra mot drivaks lingen (bilde H).

Rengjr delene.

Mikser Ta hensyn til eksemplene p bruk i tabellen. N

W Fare for skade p grunn av skarpe kniver / roterende drev! Grip aldri inn i den psatte mikseren! Mikseren m kun settes p / tas av nr drevet str stille! Mikseren m kun brukes i komplett sammensatt tilstand og med psatt lokk. Blenderen m ikke brukes nr den er tom.

W Fare for skolding! Ved bearbeiding av varme mikseprodukter, kommer det damp ut gjennom trakten i lokket. Arbeide med mikseren Bilde J:

Trykk utlsningstasten og sett svingarmen i posisjon 4.

Ta av beskyttelsesdekselet p mikserdrevet.

Sett miksebegeret p (markeringen p hndtaket mot markeringen p basismaskinen) og drei det med urviseren til stopp.

Fyll p ingredienser. Maksimal mengde, flytende = 1,25 liter; maksimal mengde skummende eller varme vsker = 0,75 liter.

Sett lokket p og drei det med urviseren til stopp inn i mikserhndtaket. Lokket m vre smekket i ls.

88

no Rengjring og pleie

Sett dreiebryteren p nsket trinn. Pfylling av ingredienser Bilde J-8:

Sl av apparatet med dreiebryteren. Ta av lokket og fyll p ingrediensene,

eller ta ut trakten og fyll de faste ingredien

sene p pfyllingspningen litt etter litt, eller

fyll flytende ingredienser p gjennom trakten.

Etter arbeidet Sl av apparatet med dreiebryteren. Drei mikseren med urviseren og ta den

av. Tips: Mikseren br helst rengjres straks etter bruk.

W OBS! Uegnede matvarer kan skade apparatet.

Varme matvarer p over 70 C m ikke tilberedes i miksebegeret.

Det m ikke bearbeides dypfryste matvarer, unntatt isbiter, med mindre det tilsettes en tilstrekkelig mengde vske.

Ikke bearbeid matvarer som inneholder harde komponenter. Fr bearbeiding av kjerne og steinfrukt (epler, fersken osv.), m kjernene eller steinene fjernes.

Merknader Begrensninger for tilberedning:

Ingredienser som mandler, lk, persille og kjtt m ikke moses.

Blenderen kan ikke brukes til lage plegg som peanttsmr, kokosntts mr eller nttemasse.

Faste matvarer m mikses med tilstrek kelig vske.

Matvarer i pulverform m blandes med tilstrekkelig vske fr miksing eller lses helt opp i vske. Matvarer i pulverform er f.eks. melis, kakao pulver, ristede soyabnner, mel og proteinpulver.

Rengjring og pleie Benyttede tilbehrsdeler m rengjres grundig etter hver bruk. X Tabell O Obs! Ikke bruk skurende rengjringsmidler. Overflatene kan bli skadet.

Rengjring av basismaskinen W Fare for elektrisk stt!

Basismaskinen m aldri dyppes ned i vann eller holdes under rennende vann. Det m ikke brukes damprenser.

Trekk ut stpselet. Basismaskinen og beskyttelseslokkene

for drevene trkes av med en fuktig klut. Ved behov kan du bruke litt oppvaskmiddel.

Gni deretter apparatet trt.

Rengjring av bolle og verkty Bollen og verktyene kan rengjres i oppvaskmaskin. Plastdelene m ikke klemmes fast i maskinen, de kan bli varig deformert under vaskingen!

Rengjring av gjennomlpskutteren

W Fare for skade p grunn av skarpe kniver!

Det m ikke gripes i de skarpe knivene og kantene p kutteskivene. For rengjring brukes en brste. Alle delene p gjennomlpskutteren kan rengjres i oppvaskmaskin. Tips: For fjerning av rdt belegg etter bearbeiding av f.eks. gulrtter, kan du smre litt matolje p en klut og trke av gjennomlpskutteren (ikke kutteskivene) med denne. Skyll deretter gjennomlpskutteren.

Rengjring av mikseren W Fare for skade p grunn

av skarpe kniver! Mikserkniven m ikke berres med bare hender.

89

noOppbevaring

Miksebeger, lokk og trakt kan rengjres i oppvaskmaskin. Tips: Etter bearbeiding av vsker, er det ofte tilstrekkelig rengjre blenderen uten ta den av apparatet. Fyll da 700 ml vann med en drpe opp vaskmiddel p den psatte blenderen. Blenderen sls p i ca. 1 minutt (trinn 7). Vaskevannet helles av, og blenderen skylles med klart vann. Viktig henvisning: Tilbehrsvesken m rengjres etter behov. Ta hensyn til henvisningene om pleie i vesken.

Oppbevaring W Fare for skade!

Nr apparatet ikke brukes, m stpselet trekkes ut. Bilde K:

Oppbevar verktyene og kutteskivene i tilbehrsvesken.

Tilbehrsvesken skal oppbevares i bollen.

Hjelp ved feil W Fare for skade!

Fr feil utbedres, m stpselet trekkes ut. Viktig henvisning: Driftsindikatoren blinker dersom det oppstr en feil ved betjeningen av apparatet, dersom de elektroniske sikringene utlses, eller dersom det oppstr en defekt p apparatet. Svingarmen m vre smekket i ls i hver av arbeidsposisjonene. Forsk frst utbedre det oppsttte problemet ved hjelp av de flgende henvisningene. Feil Apparatet starter ikke. Utbedring

Kontroller strmforsyningen. Kontroller stpselet. Kontroller svingarmen.

Er den i riktig posisjon? Er den smekket i ls?

Skru fast mikseren hhv. bollen til stopp. Sett p mikserlokket og skru det fast til

stopp. Beskyttelseslokkene settes p de drev

som ikke brukes. Sikringen mot gjeninnkobling er aktiv.

Sett apparatet p 0/off, og sett det der etter tilbake p det nskede trinnet.

Feil Apparatet slr seg av under bruk. Overlast vernet er aktivert. Det ble bearbeidet for store mengder matvarer samtidig. Utbedring

Sl av apparatet. Arbeidsmengden m reduseres.

Feil Ved en feiltakelse ble utlsningstasten betjent nr drevet var i gang. Svingarmen beveger seg oppover. Drevet sls av, men blir ikke stende i posisjonen for skift av verkty. Utbedring

Sett dreiebryteren p 0/off. Sett svingarmen i posisjon 1. Sl apparatet p (trinn 1). Sl apparatet av igjen.

Verktyet blir stende i posisjonen for skift av verkty. Feil Mikseren begynner ikke arbeide, eller blir stende under bruk, drevet brummer. Kniven er blokkert. Utbedring

Sl av apparatet og trekk ut stpselet. Ta av mikseren og fjern hindringen. Sett mikseren p igjen. Sl p apparatet.

Viktig henvisning Dersom feilen ikke lar seg utbedre p dette viset, m du henvende deg til kundeservice.

90

no Eksempler p bruk

Eksempler p bruk Flg de generelle anbefalingene i tabell L, M og N. Tillatte strste mengder m ikke overskrides.

Biskuitdeig Grunnoppskrift 2 egg 23 ss varmt vann 100 g sukker 1 pakker vaniljesukker 70 g mel 70 g potetmel evt. bakepulver Visp alt sammen (unntatt mel og

potetmel) i 46 min. p trinn 7 med vispen til det hele blir kremaktig.

Sett s dreiebryteren p trinn 1 og bland inn det silte melet og potetmelet i porsjoner av ca. til 1 minutt med n skje av gangen.

Strste mengde: 2 ganger grunnoppskriften

Rrt deig Grunnoppskrift 6 egg 500 g sukker 1 klype salt 2 pk vaniljesukker eller skall av sitron 500 g smr eller margarin

(romtemperatur) 1000 g mel 1 pk bakepulver 250 ml melk Rr sammen egg, sukker, salt og

vaniljesukker eller sitronskall i ca. 10 sekunder p trinn 1 med vispen.

Still inn p trinn 5 og la den arbeide i ca. 120 sekunder.

Tilsett smr og arbeid i ca. 60 sekunder p trinn 3.

Tilsett mel og bakepulver og arbeid i ca. 2 minutter p trinn 1.

Still inn p trinn 3 og tilsett melken litt etter litt i lpet av 2 minutter.

Strste mengde: 1 x grunnoppskriften

Tung fruktkake Grunnoppskrift 3 egg 135 g sukker 135 g margarin 255 g mel 10 g bakepulver 150 g korinter 150 g blandet trr frukt Sett inn rrepinnen. Fyll p alle ingrediensene, bortsett fra

trr frukt. Bearbeid i 30 sekunder p trinn 1. Bearbeid deretter i 35 minutter p

trinn 5. Still inn p trinn 2. Tilsett trr frukt innen 3060 sekunder.

Strste mengde: 2 x grunnoppskriften

Mrdeig Grunnoppskrift 125 g smr

(romtemperatur) 100125 g sukker 1 egg 1 klype salt litt skall av sitron eller vaniljesukker 250 g mel evt. bakepulver Bearbeid alle ingrediensene i ca.

minutt p trinn 1, deretter i ca. 36 minutter p trinn 3 med rrepinnen.

Fra 250 g mel: Elt alle ingrediensene med eltekroken ca.

min. p trinn 1, deretter 56 min. p trinn 3.

Strste mengde: 2 ganger grunnoppskriften

Gjrdeig Grunnoppskrift 500 g mel 1 egg 80 g fett (romtemperatur) 80 g sukker 200250 ml lunken melk 25 g fersk gjr eller 1 pakke trrgjrr skall av sitron 1 klype salt

91

noSpesialtilbehr

Alle ingrediensene bearbeides med elte kroken i ca. minutt p trinn 1, deretter ca. 36 minutter p trinn 3.

Strste mengde: 2 ganger grunnoppskriften

Pastadeig Grunnoppskrift 300 g mel 3 egg etter behov 12 ss (1020 g) kaldt vann alle ingrediensene bearbeides i ca.

3 til 5 minutter p trinn 3 til det dannes en deig.

Strste mengde: 1,5 ganger grunnoppskriften

Brddeig Grunnoppskrift 1000 g mel 2 pakker trrgjrr 2 ts salt 600650 ml varmt vann Alle ingrediensene bearbeides med

eltekroken i ca. minutt p trinn 1, deretter ca. 67 minutter p trinn 3.

Majones 1 egg 1 ts sennep l olje 1 ss sitronsaft eller eddik 1 klype salt 1 klype sukker

Ingrediensene m ha romtemperatur. Tilberedning av majones er bare mulig med hele egg.

Bland sammen alle ingrediensene i noen sekunder (unntatt oljen) p trinn 3 eller 4.

Sl mikseren over p trinn 7. La oljen renne langsomt igjennom trakten og miks til majonesen emulgerer.

Majonesen m brukes opp snart, ikke oppbevares.

Spesialtilbehr Spesialtilbehr Tilbehr kan kjpes hos kundeservice, hos forhandleren eller p Internett. Bruk bare originalt tilbehr, etter som dette er nyaktig tilpasset apparatet. Tilbehr er apparatspesifikt. Oppgi alltid den nyaktige betegnelsen (ENr.) p appa ratet nr du kjper tilbehr. Du kan f mer informasjon om hvilket tilbe hr som finnes for apparatet ditt, i katalogen vr, i nettbutikken eller hos kundeservice. www.bosch-home.com

Avfallshndtering

J Vennligst kast innpakningsmaterialet p en milj- og forskriftsmessig mte. Dette apparatet er klassifisert i henhold til det europeiske direk- tivet 2012/19/EU om avhending av elektrisk- og elektronisk utstyr (waste electrical and electronic equipment WEEE). Direktivet angir rammene for innlevering og gjenvinning av innbytteprodukter. Faghandelen kan gi opplysninger om aktuelle avfallsmottak.

Garanti For dette apparatet gjelder de garantibe- tingelser som er oppgitt av vr representant i de respektive land. Detaljer om disse garantibetingelsene fr du ved henvende deg til elektrohandelen der du har kjpt apparatet. Ved krav i forbindelse med garantiytelser, er det i alle fall ndvendig legge fram kvittering for kjpet av apparatet.

Det tas forbehold om endringer.

92

sv Anvndning fr avsett ndaml

Anvndning fr avsett ndaml Enheten r bara avsedd fr normalt hemmabruk. Anvnd apparaten endast fr att bearbeta sdana mngder som r normala i ett hushll. Detsamma gller bearbetningstiderna. Apparaten r avsedd fr omrrning, kndning och vispning av matvaror. Apparaten fr inte anvndas fr att bearbeta andra freml eller mnen. I kombination med andra tillbehrsdelar som stds av tillverkaren r fler anvndningsomrden mjliga. Apparaten fr bara anvndas med godknda originaldelar och originaltilbehr. Anvnd aldrig tillbehrsdelarna till andra apparater. Apparaten fr bara anvndas inomhus vid rumstemperatur och inte p hgre hjd n 2000 m ver havsytan.

Viktiga skerhetsanvisningar Ls igenom bruksanvisningen noggrant, flj den och frvara den noga! Bifoga de hr instruktionerna om du ger apparaten till ngon annan. Om du inte fljer instruktionerna fr rtt anvndning av apparaten ptar sig sig tillverkaren inte ngot ansvar fr eventuella skador som detta kan orsaka. Denna apparat fr anvndas av personer med reducerade fysiska, sensoriska eller mentala frmgor och brist p erfarenhet och/eller kunskap, om de str under verinseende eller om de instruerats i anvndningen av maskinen och informerats om riskerna. Lt inte barn komma i nrheten av apparaten och ntkabeln och lt dem inte manvrera apparaten. Lt inte barn leka med enheten. Rengring och anvndarunderhll fr inte utfras av barn.

W Risk fr elektrisk stt och brand! Apparaten fr bara anslutas och anvndas enligt uppgifterna

p typskylten. Anvnd den bara om ntkabeln och apparaten r oskadade. Reparation av apparaten, t.ex. om ntkabeln har skadats och mste bytas, fr bara utfras av vr kundtjnst fr att undvika risker.

Anvnd enbart strmvredet fr att starta och stnga av apparaten. Anslut aldrig apparaten till en timer eller till ett eluttag som styrs

med fjrrkontroll. Ha alltid apparaten under tillsyn nr den r igng! Stll inte apparaten p eller i nrheten av heta ytor, t.ex.

kokplattor. Lt aldrig ntkabeln komma i kontakt med varma delar eller skarpa kanter.

Motordelen fr aldrig snkas ned i vatten eller maskindiskas. Anvnd aldrig ngrengring. Ta inte i apparaten med vta hnder.

Dra alltid ut ntkabeln ur uttaget efter varje anvndning, nr du inte har apparaten under uppsikt, fre hopsttning, isrtagning eller rengring och om ett fel skulle uppkomma.

93

svViktiga skerhetsanvisningar

W Risk fr personskador! Innan du byter tillbehr eller tillsatser som rr sig under

anvndningen mste du frst stnga av apparaten och dra ut ntkabeln ur uttaget. Efter avstngning fortstter drivuttaget att rotera en kort stund. Vnta tills drivningen str helt stilla.

ndra inte den stllbara funktionsarmen medan apparaten r igng.

Anvnd verktygen bara om sklen r insatt, locket r psatt och skyddslocken ver drivningarna har monterats. Stt in sklen, locket och drivningsskydden enligt instruktionerna nr du anvnder tillbehr!

Stick aldrig in handen i sklen eller pfyllningsrret nr apparaten r igng. Fr inte in ngra freml (t.ex. slevar) i sklen eller pfyllningsrret. Hll hnder, hr, klder och andra freml borta frn roterande delar.

Anvnd aldrig verktyg och tillbehr eller 2 tillbehr samtidigt. Nr du anvnder tillbehr mste du flja bde den hr bruksanvisningen och eventuella medfljande bruksanvisningar.

Anvnd tillbehret bara i komplett hopsatt tillstnd. Montera aldrig ihop tillbehret p motordelen. Anvnd bara tillbehret i det avsedda arbetslget.

Rr aldrig riv och skrskivornas vassa knivar och kanter. Hll bara i kanten p riv och skrskivorna!

Rr inte mixerknivarna med bara hnderna. Stick aldrig in fingrarna i den psatta mixern! Anvnd aldrig

mixern om inte locket r psatt. Var frsiktig nr du hanterar de vassa knivarna, nr du tmmer

behllaren och vid rengringen. W Risk fr brnnskador.

Nr heta ingredienser bearbetas i mixern trnger nga ut genom tratten i locket.

W Risk fr kvvning! Lt inte barn leka med frpackningsmaterialet.

W Varning! Vi rekommenderar dig att inte lta apparaten vara igng lngre tid n vad som behvs fr att bearbeta matvarorna. Lt inte apparaten g p tomgng.

W Viktigt! Du mste rengra apparaten noggrant efter varje anvndning och om den inte har anvnts under en lngre tid (X Rengring och sktsel se sidan 99).

94

sv Viktiga skerhetsanvisningar

verbelastningsskydd Om motorn stnger av sig sjlv under anvndningen har verbelastningsskyddet aktiverats. En mjlig orsak kan vara att alltfr stora mngder matvaror bearbetas samtidigt. Se Rd vid fel om hur du ska gra nr ett skerhetssystem aktiveras. Apparaten r underhllsfri.

versikt Bild A Motordel 1 Lsknapp 2 Stllbar funktionsarm

Funktionen Easy Armlift stder armens upptrrelse (se Arbetslgen).

3 Strmvred Efter avstngningen (lge 0/off) krs apparaten automatiskt till optimalt lge fr byte av verktyg. 0/off = Stopp M = momentlge med hgsta varvtal, hll fast under den nskade mixningstiden. Steg 1-7, Arbetshastighet: 1 = lgt varvtal lngsam, 7 = hgt varvtal snabb.

4 Driftsymbol Lyser nr apparaten anvnds (strmvredet str i lge M eller 1-7). Blinkar nr apparaten anvnds felaktigt stt, nr den elektroniska skringen lser ut eller vid apparatfel, se kapitlet Rd vid fel.

Vi gratulerar dig till ditt kp av en ny apparat frn Bosch. Mer information om vra produkter finns p vr Internet-sida.

Innehll Anvndning fr avsett ndaml ................92 Viktiga skerhetsanvisningar ....................92 Skerhetssystem ......................................94 versikt ....................................................94 Arbetslgen ..............................................95 Anvndning...............................................96 Rengring och sktsel ..............................99 Frvaring ................................................100 Rd vid fel...............................................100 Anvndningsexempel ............................100 Specialtillbehr .......................................102 Avfallshantering ......................................102 Konsumentbestmmelser .......................102

W Frklaring av symbolerna p apparaten eller tillbehren

i Flj instruktionerna i bruksanvisningen.

Y Frsiktigt! Roterande knivar.

W Frsiktigt! Roterande verktyg. Stick inte in fingrarna i pfyllningsppningen.

Skerhetssystem Skerhetssprr Se tabellen "Arbetslgen. Det gr bara att starta apparaten i lge 1 och 3:

om blandarsklen (11) har satts in och vridits tills den snppt fast.

Skerhetssprr vid strmavbrott Vid strmavbrott frblir apparaten pslagen, men motorn startar sedan inte p nytt. Starta om apparaten genom att frst vrida strmvredet till 0/off och drefter starta apparaten.

95

svArbetslgen

5 Skyddslock ver drivning Ta bort skyddslocket ver drivningen genom att trycka baktill p locket och ta av det.

6 Drivning fr grnsaksskrare och citruspress (extra tillbehr*). Stt p skyddslocket nr drivningen inte anvnds.

7 Drivning fr verktyg (grovvisp, ballongvisp, degkrok) och kttkvarn (extra tillbehr*)

8 Skyddslock ver mixerdrivningen 9 Mixerdrivning (extra tillbehr*)

Stt p skyddslocket p mixerdrivningen nr den inte anvnds.

10 Automatisk kabelupprullning Blandarskl med tillbehr 11 Blandarskl av rostfritt stl 12 Lock Verktyg 13 Grovvisp Profi Flexi 14 Ballongvisp Profi 15 Degkrok med degavstrykare 16 Tillbehrsvska

Fr frvaring av verktyg och skr och rivskivor.

Grnsaksskrare 17 Pmatare 18 Lock med pfyllningsppning 19 Riv- och skrskivor

a Vndskiva Profi Supercut tjock / tunn

b Strimlingsvndskiva grov/fin c Rivskiva fin d Vndbar skr och strimlingsskiva*

20 Skivhllare 21 Hus med utloppsppning Mixer* 22 Mixerbgare 23 Lock 24 Tratt * Om ett tillbehr inte ingr i leveransen kan det kpas i fackhandeln och frn vr kundtjnst.

Arbetslgen Bild B Varning! Anvnd apparaten bara om verktygen / tillbehren r fastsatta enligt tabellen p rtt drivning och i rtt position och str i arbetslge. Den stllbara funktionsarmen mste snppa fast i varje arbetslge. Obs.! Den stllbara funktionsarmen r utrustad med funktionen Easy Armlift som stder funktionsarmens upptrrelse.

Instllning av arbetslge: Tryck p lsknappen och vrid

funktionsarmen. Std rrelsen med ena handen.

Vrid funktionsarmen tills den snpper fast i nskat lge.

Lge Drivning Verktyg/ tillbehr

Arbets- hastighet

1 7

17

15

13

2 7 *

3 6 37

35

4

9 57

7 57

96

sv Anvndning

* Insttning / borttagning av ballongvisp, grovvisp och degkrok.

Anvndning W Risk fr personskador!

Stt inte in stickkontakten i vgguttaget frrn alla frberedelser fr arbetet med apparaten r klara. Varning! Anvnd bara apparaten med tillbehren / verktygen i arbetslge. Kr inte en tom apparat. Utstt inte apparaten och tillbehren fr stark vrme. Delarna r inte lmpliga fr mikrovgsugn.

Rengr apparaten och tillbehren noggrant fre frsta anvndningen, se Rengring och sktsel.

Frberedelser Stll motordelen p ett sltt och rent

underlag. Dra ut kabeln till nskad lngd (hgst

100 cm) med ett enda drag och slpp den sedan lngsamt. D sprras kabeln (bild C).

Minskning av kabelns arbetslngd: Dra ltt i kabeln och lt den rulla in till nskad lngd. Dra drefter p nytt ltt i kabeln och slpp den lngsamt; d sprras kabeln.

Varning! Om kabeln fastnar mste du dra ut den helt och sedan lta den rullas upp igen.

Stt stickkontakten i vgguttaget.

Blandarskl och verktyg Flj tillmpningsexemplen i tabellen. L

W Risk fr personskador p grund av roterande verktyg! Stick inte in handen i blandarsklen nr apparaten r igng. Locket (12) ska alltid vara psatt nr maskinen r igng! Byt verktyg bara nr drivningen str stilla nr apparaten har stngts av fortstter drivningen att rotera en kort stund och stannar i verktygsbyteslget.

Rr inte funktionsarmen frrn verktyget str stilla. Tck ver drivningar som inte anvnds med skyddslocken. Varning! Anvnd blandarsklen bara fr arbeten med denna apparat. Grovvisp Profi Flexi (13) fr kndning av smet, t.ex. kaksmet, fruktkakor etc. och fr nedrrning av ingredienser som russin och chokladspn Ballongvisp Profi (14) fr vispning av ggvita och grdde (minst 30 % fetthalt) och fr bland ning av kaksmet Degkrok (15) fr kndning av deg, t.ex. jsdeg, brddeg, pizzadeg, nudeldeg, kakdeg, och fr nedrrning av ingredienser som frn i degen Viktigt ppekande om anvndning av ballongvispen (bild D): Fr att ingredienserna ska blandas optimalt br ballongvispen nstan vidrra blandarsklens botten. Om den inte gr det kan du justera ballongvispens hjd s hr:

Dra ut kontakten. Tryck p lsknappen och vrid

funktionsarmen till lge 2. Stt in ballongvispen i driv

ningen tills den snpper fast. Hll fast ballongvispen och lossa

muttern medurs med skiftnyckeln (nyck elvidd 8 mm).

Stll in optimal hjd fr ballongvispen genom att vrida vispen: Vridning medurs: Lyft. Vridning moturs: Snk

Tryck p lsknappen och vrid funktionsarmen till lge 1.

Kontrollera ballongvispens hjd och justera den om det behvs.

Nr hjden r rtt instlld trycker du p lsknappen och fr funktionsarmen till lge 2.

97

svAnvndning

Hll fast ballongvispen och dra t muttern moturs med skiftnyckeln (nyck elvidd 8).

Arbete med blandarsklen och verktygen (bild E):

Tryck p lsknappen och vrid funktionsarmen till lge 2.

Insttning av blandarsklen: Luta sklen framt, stt p den och stll ned den. Vrid den moturs tills den snpper fast.

Stt allt efter bearbetningsndamlet in grovvispen, ballongvispen eller degkroken i drivningen tills de snpper fast.

OBS.! Nr du anvnder degkroken mste du vrida degavstrykaren tills degkroken kan snppa fast (bild E4b).

Fyll p de ingredienser som ska bearbetas i blandarsklen.

Tryck p lsknappen och vrid funktionsarmen till lge 1.

Stt p locket. Stll strmvredet i nskat lge.

Pfyllning av ingredienser Stng av apparaten med strmvredet. Fyll p ingredienserna genom

pfyllningsppningen i locket. eller

Ta av locket. Tryck p lsknappen och vrid

funktionsarmen till lge 2. Fyll p ingredienserna.

Efter arbetet Stng av apparaten med strmvredet. Dra ur kontakten. Ta av locket. Tryck p lsknappen och vrid

funktionsarmen till lge 2. Ta ut verktyget ur drivningen. Ta bort blandarsklen. Rengr alla delar, se Rengring och

sktsel.

Grnsaksskrare Flj tillmpningsexemplen i tabellen. M

W Risk fr personskador! Rr aldrig riv och skrskivornas vassa knivar och kanter. Hll bara i kanten p riv och skrskivorna! Grnsaksskraren fr bara sttas p eller tas av nr drivningen str stilla och stickkontakten r uttagen. Stick aldrig ned fingrarna i pfyllningsrret. Varning! Anvnd grnsaksskraren enbart i komplett hopmonterat tillstnd. Montera aldrig ihop grnsaksskraren p motordelen. Anvnd grnsaksskraren enbart i det beskrivna arbetslget. verbelastningsskydd Bild F Fr att inte allvarliga skador ska uppkomma p din apparat om grnsaksskraren verbelastas r grnsaksskrarens drivaxel frsedd med en skra (brottanvisning). Vid verbelastning bryts drivaxeln av i denna punkt. Du kan bestlla en ny skivhllare med drivaxel frn kundtjnsten. Vndskiva Profi Supercut tjock / tunn fr skrning av matvaror i tunna eller tjocka skivor, t.ex. frukt och grnsaker. Mrkning:

Grov = tjocka skivor Fin = tunna skivor

Obs.: Inte lmplig fr bearbetning av hrdost, brd ,smbrd eller choklad. Tips: Skr kokt potatis frst efter att den har svalnat. Strimlingsvndskiva grov/fin fr strimling av matvaror i grova eller fina bitar, t.ex. frukt, grnsaker eller ost, som Gouda eller Edamer. Mrkning:

2 = grova sidan 4 = fina sidan

Obs.: Inte lmplig fr bearbetning av ntter eller hrdost, t.ex. parmesan. Tips: Strimla mjukost med den grova sidan.

98

sv Anvndning

Rivskiva fin fr finstrimling av matvaror, t.ex. ntter eller hrdost, t.ex. parmesan. Obs.: Inte lmplig fr bearbetning av mjukost och skivad ost. Vndbar skr- och strimlingsskiva fr strimling av r potatis eller fr skrning i skivor. Obs.: Inte lmplig fr bearbetning av fiber rika matvaror , t.ex. vitlk eller mango. Arbete med grnsaksskraren Bild G:

Tryck p lsknappen och vrid funktionsarmen till lge 2.

Insttning av blandarsklen: Luta sklen framt, stt p den och stt sedan ned den. Vrid den moturs tills den snpper fast.

Tryck p lsknappen och vrid funktionsarmen till lge 3.

Lossa skyddslocket frn grn saksskrarens drivning (bild G-5a).

Hll fast skivhllaren nedtill. De bda spetsarna ska peka uppt.

Placera den nskade skr eller strimmelskivan frsiktigt p skivhllarens spetsar (bild G-6a). Fr vndskivor mste du kontrollera att den nskade sidan r vnd uppt.

Fatta skivhllaren upptill och stt in den i huset (bild G-6b).

Stt p locket (observera markeringen) och vrid det medurs till stopp.

Stt grnsaksskraren p drivningen s som bild G-8 visar och vrid den medurs till stopp.

Vrid strmvredet till rekommenderat lge.

Lgg de matvaror som ska bearbetas i matarrret och tryck ned dem med pmataren.

Varning! Lgg inte in fr mycket skrgods s att det blir stopp i utloppsppningen. Tips: Fr att f ett jmnt skrresultat br du bearbeta tunt skrgods i buntar.

Obs.! Om de matvaror som du bearbetar fastnar i grnsaksskraren mste du stnga av kksmaskinen, dra ut stickkontakten och vnta tills drivningen str stilla. Ta sedan av grnsaksskrarens lock och tm matarrret. Efter arbetet

Stng av apparaten med strmvredet. Vrid grnsaksskraren moturs och ta av

den. Vrid locket moturs och ta av det. Lyft ut skivhllaren och skivan. Tryck

d med fingret underifrn mot drivaxeln (bild H).

Rengr alla delar.

Mixer Flj tillmpningsexemplen i tabellen. N

W Risk fr personskador p grund av vassa knivar / roterande drivning! Stick aldrig in fingrarna i den psatta mixern! Mixern fr bara sttas p eller tas av nr drivningen str stilla! Mixern fr bara kras hopmonterad och med psatt lock. Kr inte mixern nr den r tom.

W Risk fr skllning! Nr heta ingredienser bearbetas i mixern trnger nga ut genom tratten i locket. Att arbeta med mixern Bild J:

Tryck in lsknappen och stll svngarmen i lge 4.

Ta bort skyddslocket frn mixerdrivningen.

Stt p mixerbgaren (markeringen p handtaget mot markeringen p motordelen) och vrid den moturs till stopp.

Fyll p ingredienserna. Strsta mngd vtska = 1,25 liter; strsta mngd skummande eller heta vtskor = 0,75 liter.

Stt p locket och vrid det moturs till stopp i mixerhandtaget. Locket mste snppa fast.

Stll strmvredet i nskat lge. Pfyllning av ingredienser Bild J-8:

Stng av apparaten med strmvredet.

99

svRengring och sktsel

Ta av locket och fyll p ingredienserna eller

ta ut tratten och fyll p de fasta ingredienserna litet i taget genom pfyllningsppningen

eller fyll p flytande ingredienser genom

tratten. Efter arbetet

Stng av apparaten med strmvredet. Vrid mixern medurs och ta av den.

Tips: Rengr helst mixern direkt efter anvndningen.

W Varning! Olmpliga matvaror kan skada apparaten.

Bearbeta inga matvaror som r varmare n 70 C i mixerbgaren.

Bearbeta inte djupfrysta matvaror, med undantag fr istrningar om de har legat i en tillrcklig mngd vtska.

Bearbeta inte matvaror som innehller hrda bestndsdelar. Innan du bear betar krn och stenfrukter (pplen, persikor etc.) mste du ta bort krnor och stenar.

Anmrkningar: Begrnsningar fr bearbetningen:

Finfrdela inte ingredienser som mandel, lk, persilja och ktt.

Mixern kan inte framstlla plgg som jordntssmr, kokossmr eller ntsmr.

Blanda ut fasta matvaror med tillrcklig mngd vtska.

Blanda ut pulverformiga matvaror fre mixningen med tillrcklig mngd vtska eller ls upp helt i vtska. Pul verformiga livsmedel r t.ex. florsocker, kakaopulver, rostade sojabnor, mjl, ggvitepulver.

Rengring och sktsel Rengr alla anvnda tillbehrsdelar noggrant efter varje anvndning. X Tabell O Varning! Anvnd inga repande rengringsmedel. Du kan skada ytorna.

Rengring av motordelen W Risk fr elektrisk stt!

Doppa aldrig motordelen i vatten och hll den inte under rinnande vatten. Anvnd inte ngrengrare.

Dra ur kontakten. Torka av motordelen och skyddslocken

med en fuktig trasa. Anvnd vid behov litet handdiskmedel.

Torka sedan apparaten torr.

Rengring av blandarsklen och verktygen Blandarsklen och verktygen gr att maskindiska. Klm inte fast plastdelarna i diskmaskinen eftersom de kan deformeras under diskningen!

Rengring av grnsaksskraren W Risk fr skada pga vassa knivar!

Ta inte i de vassa knivarna och skrytorna p riv och skrskivorna. Anvnd en borste fr rengring. Alla grnsaksskrarens delar gr att maskindiska. Tips: Ta bort rd belggning efter bearbet ning av t.ex. mortter genom att hlla ngra droppar matolja p en trasa och gnida grn saksskraren (inte riv och skrskivorna) med den. Sklj sedan grnsaksskraren.

Rengring av mixern W Risk fr personskador p grund av

vassa knivar! Rr inte mixerknivarna med bara hnderna. Mixerbgaren, locket och tratten gr att maskindiska. Tips: Efter bearbetning av vtskor r det ofta tillrckligt att rengra mixern utan att ta av den frn apparaten. Hll d 700 ml vatten med en droppe diskmedel i den psatta mixern. Kr mixern i ungefr 1 minut (lge 7). Hll bort diskvatt net och sklj ur mixern med rent vatten. Viktigt ppekande: Rengr tillbehrsvskan vid behov. Flj sktselanvisningarna som finns i vskan.

100

sv Frvaring

Frvaring W Risk fr personskador!

Dra ut stickkontakten om apparaten inte ska anvndas. Bild K

Stuva verktyg och riv och skrskivor i tillbehrsvskan.

Frvara tillbehrsvskan i blandarsklen.

Rd vid fel W Risk fr personskador!

Dra ut stickkontakten innan du tgrdar ett fel. Viktigt ppekande: Om apparaten anvnds p felaktigt stt, om de elektroniska skringarna lser ut eller vid ett apparatfel visas detta genom att driftsymbolen blinkar. Den stllbara funktionsarmen mste snppa fast i varje arbetslge. Frsk i frsta hand att tgrda problemet med hjlp av anvisningarna nedan. Fel Maskinen startar inte. tgrd

Kontrollera strmfrsrjningen. Kontrollera stickkontakten. Kontrollera funktionsarmen.

Str den i rtt lge? Har den snppt fast?

Vrid mixern eller blandarsklen till stopp. Stt p locket p mixern och vrid det till

stopp. Stt p skyddslock p drivningar som

inte anvnds. Skerhetssprren vid strmavbrott har

aktiverats. Stll apparaten i lge 0/off och drefter tillbaka till nskat lge.

Fel Apparaten stngs av under anvndningen. verbelastningsskyddet har aktiverats. Fr mycket matvaror har bearbetats samtidigt.

tgrd Stng av apparaten. Minska bearbetningsmngden.

Fel Lsknappen har tryckts in av misstag medan drivningen var igng. Funktionsarmen rr sig uppt. Drivningen stngs av men stannar inte i verktygsbyteslget. tgrd

Vrid strmvredet till 0/off. Vrid funktionsarmen till lge 1. Starta apparaten (lge 1). Stng av apparaten.

Verktyget stannar i verktygsbyteslget. Fel Mixern brjar inte arbeta eller stannar under anvndning, drivningen brummar. Kniven har fastnat. tgrd

Stng av apparaten och dra ut stickkontakten.

Ta av mixern och ta bort det som har fastnat.

Stt p mixern igen. Starta maskinen.

Viktigt ppekande Om felet inte gr att tgrda p detta stt mste du vnda dig till kundtjnsten.

Anvndningsexempel Flj de allmnna rekommendationerna i tabellerna L, M och N. verskrid inte de tilltna maximala mngderna.

Deg fr sockerkaka Grundrecept 2 gg 23 msk hett vatten 100 g socker 1 pkt vaniljsocker 70 g vetemjl 70 g potatismjl ev. bakpulver

101

svAnvndningsexempel

Vispa ingredienserna med ballongvis pen (utom vete och potatismjl) ca 46 min i lge 7 till skum.

Vrid strmvredet till lge 1 och blanda ned det siktade vete och potatismjlet skedvis under ca 1 min.

Max mngd: 2 ggr grundreceptet

Sockerkaksmet: Grundrecept 6 gg 500 g socker 1 nypa salt 2 smpaket vanillinsocker

eller skalet av citron 500 g smr eller margarin (rumsvarmt) 1000 g mjl 1 smpaket bakpulver 2,5 dl mjlk Rr ihop gg, socker, salt och vanillin

socker eller citronskal cirka 10 sekunder p steg 1 med vispen.

Stll in steg 5 och bearbeta i cirka 120 sekunder.

Tillstt smret och bearbeta cirka 60 sekunder p steg 3.

Tillstt mjl och bakpulver och bearbeta cirka 2 minuter p steg 1.

Stll in steg 3 och tillstt mjlken undan fr undan under 2 minuter.

Strsta mngd: 1 x grundreceptet

Tjock fruktkaka Basrecept 3 gg 135 g socker 135 g margarin 255 g mjl 10 g bakpulver 150 g korinter 150 g blandad torkad frukt Stt in grovvispen. Tillstt alla ingredienser utom den

torkade frukten. Bearbeta i 30 sekunder i lge 1. Bearbeta sedan 35 minuter i lge 5. Stll in lge 2. Tillstt inom 3060 sekunder den

torkade frukten. Strsta mngd: 2 gnger grundreceptet

Mrdeg Grundrecept 125 g smr (rumsvarmt) 100125 g socker 1 gg 1 krm salt lite citronskal eller vaniljsocker 250 g vetemjl ev. bakpulver Bearbeta alla ingredienserna i cirka

minut i lge 1, och sedan i cirka 36 minuter i lge 3 med grovvispen.

Minst 250 g mjl: Knda ingredienser med degkroken

ca min i lge 1, och sedan ytterligare ca 56 min i lge 3.

Max mngd: 2 ggr grundreceptet

Jsdeg Grundrecept 500 g vetemjl 1 gg 80 g fett (rumsvarmt) 80 g socker 200250 ml fingervarm mjlk 25 g frsk jst eller 1 pkt torrjst Skalet av en citron 1 krm salt Bearbeta alla ingredienser med

degkroken ca minut i lge 1 och sedan ca 36 minuter i lge 3.

Max mngd: 2 ggr grundreceptet

Nudeldeg Grundrecept 300 g vetemjl 3 gg efter behov 12 msk (1020 g) kallt

vatten Bearbeta samtliga ingredienser ca. 3 till

5 minuter i lge 3 till deg. Max mngd: 1,5 ggr grundreceptet

102

sv Specialtillbehr

Brddeg Grundrecept 1000 g vetemjl 2 pkt torrjst 2 tsk salt 600650 ml varmt vatten Bearbeta alla ingredienser med

degkroken ca minut i lge 1 och sedan ca 67 minuter i lge 3.

Majonns 1 gg 1 tsk senap l olja 1 msk citronsaft eller ttika 1 nypa salt 1 nypa socker

Ingredienserna ska ha rumstemperatur. Tillredning av majonns mste ske med hela gg.

Bearbeta ingredienserna (utom matol jan) ngra sekunder i mixern i lge 3 eller 4.

Stll mixern i lget 7 och hll matoljan lngsamt genom tratten och fortstt blanda tills majonnsen emulgerar.

Majonnsen ska inte frvaras utan konsumeras snart.

Specialtillbehr Specialtillbehr/tillbehr kan kpas frn kundtjnsten, i fackhandeln eller p Inter net. Anvnd enbart originaltillbehr. De r exakt anpassade till apparaten. Tillbehren r apparatspecifika. Ange alltid din apparats exakta beteckning (ENr.) vid kpet. De tillbehr som finns till din apparat visas i vr katalog, i onlineshopen och hos kundtjnsten. www.bosch-home.com

Avfallshantering

J Kassera frpackningen p ett miljvnligt stt. Denna enhet r mrkt i enlighet med der europeiska direktivet 2012/19/EU om avfall som utgrs av eller innehller elektro- niska produkter (waste electrical and electronic equipment WEEE). Direktivet anger ramarna fr inom EU giltigt tertagande och korrekt tervinning av uttjnta enheter. Kontakta din fackhandel om du vill ha ytterligare information.

Konsumentbestmmelser I Sverige gller av EHL antagna konsument bestmmelser. Den fullstndiga texten finns hos din handlare. Spar kvittot.

Rtt till ndringar frbehlls.

103

fiMryksenmukainen kytt

Mryksenmukainen kytt Tm laite on tarkoitettu kytettvksi yksityisess kotitaloudessa ja kodinomaisessa ympristss. Se ei sovellu ammattimaiseen kyttn. Kyt laitetta vain kotitalouksissa tavallisten mrien ksittelyyn ja keskeytyksett ainoastaan ohjeissa ilmoitetun ajan. Laite soveltuu elintarvikkeiden sekoittamiseen ja vatkaamiseen sek taikinan vaivaamiseen. Laitetta ei saa kytt muiden tarvikkeiden / aineiden ksittelyyn. Muiden valmistajan hyvksymien lisvarusteiden kanssa voit kytt sit mys muihin kytttarkoituksiin. Kyt laitteessa ainoastaan hyvksyttyj valmistajan alkuperisi osia ja varusteita. l koskaan kyt muille laitteille tarkoitettuja varusteita. Kyt laitetta vain sistiloissa huoneenlmmss ja enint. 2000 metrin korkeudessa merenpinnan ylpuolella.

Trkeit turvallisuusohjeita Lue kyttohje tarkkaan, noudata siin olevia ohjeita ja silyt se huolellisesti! Kun annat laitteen toiselle henkillle, anna mukana mys tm kyttohje. Jos laitteen kyttohjeet laiminlydn, valmistaja ei ole vastuussa ohjeidenvastaisesta kytst aiheutuvista vahingoista. Fyysisilt, sensorisilta tai henkisilt valmiuksiltaan rajoitteiset taikka kokemattomat ja/tai taitamattomat henkilt voivat kytt tt laitetta, jos heidn turvallisuudestaan vastaava henkil valvoo heit tai on perehdyttnyt heidt laitteen turvalliseen kyttn ja kytst aiheutuviin vaaroihin. Lapset on pidettv loitolla laitteesta ja virtajohdosta eivtk he saa kytt laitetta. Lapset eivt saa leikki laitteella. Lapset eivt saa suorittaa puhdistusta ja itse tehtv huoltoa.

W Shkisku- ja palovaara! Kytke laite ja kyt sit ainoastaan tyyppikilvess mainittujen

tietojen mukaisessa shkverkossa. Kyt laitetta vain, kun liitntjohto ja laite ovat moitteettomassa kunnossa. Laitteen saa turvallisuussyist korjata, esim. vaihtaa vioittuneen liitntjohdon, vain valtuutettu huoltoliike.

Kynnist ja pysyt laite ainoastaan valitsimesta. l kytke laitetta ajastimeen tai kaukoohjattavaan pistorasiaan.

Valvo laitetta aina kytn aikana! l aseta laitetta kuumien pintojen, esim. keittolevyjen, plle

tai lheisyyteen. Verkkojohto ei saa joutua kosketuksiin kuumien osien kanssa eik sit saa vet tervien reunojen yli.

104

fi Trkeit turvallisuusohjeita

l koskaan upota peruslaitetta veteen tai pese sit astianpesukoneessa. l kyt hyrypuhdistinta. l kyt laitetta mrin ksin.

Laite on irrotettava verkkovirrasta aina, kun sen kytt lopetetaan, sit ei voida valvoa, ennen sen kokoamista, purkamista tai puhdistusta sek hiritilanteissa. W Loukkaantumisvaara!

Katkaise laitteesta virta ja irrota se verkkovirrasta, ennen kuin vaihdat varusteita tai lisosia, jotka liikkuvat laitteen ollessa toiminnassa. Kone ky viel jonkin aikaa pysyttmisen jlkeen. Odota, ett kone pyshtyy kokonaan.

l muuta varren asentoa laitteen virran ollessa kytkettyn. Kyt vlineit vain, kun kulho, kansi ja kyttliitntjen

suojakannet ovat paikoillaan! Kun kytt lisvarusteita, kiinnit kulho, kansi ja kyttliitntjen suojakannet ohjeiden mukaisesti!

l koske kulhon tai tyttsuppilon sislle koneen ollessa toiminnassa. l tynn kulhoon tai tyttaukkoon esineit (esim. lastaa). Pid kdet, hiukset, vaatteet tms. loitolla pyrivist osista.

l kyt koskaan samanaikaisesti koneen omia tarvikkeita ja lisvarustetta tai 2 lisvarustetta. Kun kytt lisvarusteita, noudata sek tt ohjetta ett varusteiden mukana toimitettavia kyttohjeita.

Kyt varustetta vain, kun sen kaikki osat ovat paikoilleen kiinnitettyin. Kokoa varuste aina ennen kuin asennat sen laitteen runkoon. Kyt varustetta vain sille tarkoitetussa kyttasennossa.

l koske hienonnusterien terviin teriin tai syrjiin. Tartu hienonnusteriin vain tern reunasta!

l koske tehosekoittimen tern paljain ksin. l koske paikalleen kiinnitetyn tehosekoittimen sislle!

l koskaan kyt tehosekoitinta ilman kantta. Ole varovainen ksitellesssi tervi teri, tyhjentesssi astiaa

ja puhdistaessasi laitetta. W Polttamisvaara!

Kannessa olevan suppilon kautta tulee ulos hyry sekoitettaessa kuumia aineksia.

W Tukehtumisvaara! l anna lasten leikki pakkausmateriaalilla.

W Huomio! l jt laitetta kyntiin pidemmksi aikaa kuin mit tarvitset elintarvikkeiden ksittelyyn. l kyt laitetta tyhjkynnill.

105

fiTrkeit turvallisuusohjeita

Turvajrjestelmt Turvalukko Katso taulukko Kyttasennot. Koneen voi kynnist asennoissa 1 ja 3 vain:

kun kulho (11) on paikallaan ja lukkiutu nut kiinni.

Uudelleenkynnistymissuoja Shkkatkon sattuessa kone j plle, mutta moottori ei kynnisty, kun shkt taas kytkeytyvt plle. Aseta valitsin ensin asentoon 0/off ja kynnist sitten kone.

Ylikuormitussuoja Jos moottori sammuu itsestn kytn aikana, ylikuormitussuoja on aktivoitunut. Syyn saattaa olla, ett on ksitelty samanaikaisesti suurempia mri aineksia. Katso kappaleesta Toimenpiteit kytthiriiden varalle miten on toimittava, jos turvajrjestelm aktivoituu. Laite ei tarvitse huoltoa.

Onneksi olkoon, valintasi on Bosch. Listietoja tuotteistamme lydt internet-sivuiltamme.

Sislt Mryksenmukainen kytt ..................103 Trkeit turvallisuusohjeita .....................103 Turvajrjestelmt ....................................105 Yhdell silmyksell ...............................106 Kyttasennot.........................................106 Kytt .....................................................107 Puhdistus ja hoito ................................... 111 Silytys ................................................... 111 Toimenpiteit kytthiriiden varalle..... 111 Kyttesimerkkej ................................. 112 Lisvarusteet .......................................... 114 Jtehuolto ............................................... 114 Takuu ...................................................... 114

W Trke! Laite on ehdottomasti puhdistettava huolellisesti jokaisen kytn jlkeen tai kun sit ei ole kytetty pitkn aikaan (X Puhdistus ja hoito katso sivu 111).

W Laitteeseen tai lisvarusteeseen kiinnitettyjen symbolien selitykset

i Noudata kyttohjeita.

Y Varoitus! Pyriv ter.

W Varoitus! Pyriv varuste. l tartu tyttaukkoon.

106

fi Yhdell silmyksell

Yhdell silmyksell Kuva A: Peruslaite 1 Vapautuspainike 2 Varsi

Easy Armlift toiminnon avulla varsi liikkuu ylspin (katso Kyttasennot).

3 Valitsin Kun pysytt koneen (asento 0/off), se asettuu automaattisesti optimaaliseen asentoon varusteiden vaihtamista varten. 0/off = pysytys M = pitoasento, suurin kyttnopeus, pid valitsin alaspainettuna haluamasi ajan. Teho 1-7, kyttnopeudet: 1 = alhainen kierrosnopeus hidas, 7 = suuri kierrosnopeus nopea.

4 Toiminnan nytt Valo palaa laitteen ollessa toiminnassa (valitsin asennossa M tai 1-7). Valo vilkkuu, jos laitetta kytetn vrin, jos elektroninen turvakytkin laukeaa tai laitteeseen tulee vika, katso kappale Toimenpiteit kytthiriiden varalle.

5 Kyttliitnnn suojakansi Irrota kyttliitnnn suojakansi painamalla sit takaosasta ja poista kansi.

6 Kyttliitnt vihannesleikkurille ja sitruspusertimelle (lisvaruste*). Kun et kyt lislaitteita, aseta kyttliitnnn suojakansi paikoilleen.

7 Kyttliitnt varusteille (pallovispil, vispil, taikinakoukku) ja lihamyllylle (lisvaruste *)

8 Tehosekoittimen kyttliitnnn suojakansi

9 Tehosekoittimen kyttliitnt (lisvaruste*) Kun et kyt lislaitteita, aseta kyttliitnnn suojakansi paikoilleen.

10 Johdon automaattinen kelaus

Kulho varusteineen 11 Terskulho 12 Kansi Varusteet 13 Vispil Profi Flexi 14 Pallovispil Profi 15 Taikinakoukku, jossa on

taikinanohjain 16 Varustelaukku

Varusteiden ja hienonnusterien silyttmiseen.

Vihannesleikkuri 17 Syttpainin 18 Kansi, jossa on tyttsuppilo 19 Hienonnustert

a Knnettv viipalointiter Profi Supercut paksu / ohut

b Knnettv raastinter karkea / hieno

c Raasteter hieno d Knnettv viipalointi

ja raastinter* 20 Ternpidin 21 Runko ja poistoaukko Tehosekoitin* 22 Kulho 23 Kansi 24 Suppilo * Jos jokin varuste ei ole laitteen mukana vakiovarusteena, voit hankkia sen alan liikkeist tai huoltopalvelusta.

Kyttasennot Kuva B: Huomio! Kyt konetta vain, kun varuste/lisvaruste on kiinnitetty seuraavan taulukon mukaisesti oikeaan kyttliitntn ja paikkaan ja se on oikeassa kyttasennossaan. Kntyvn varren tulee aina lukittua kyttasentoon. Huomautus Varressa on Easy Armlift toiminto, jonka avulla varsi kntyy helpommin yls.

107

fiKytt

Kyttasennon st: Paina avaamispainiketta ja vaihda

varren asento. Kyt apuna ktt. Siirr varsi haluamaasi asentoon niin,

ett se lukittuu kiinni. Asento Kyttliitnt Varuste/

lisvaruste Kyt- tnopeus

1 7

17

15

13

2 7 *

3 6 37

35

4

9 57

7 57

* Vispiln, pallovispiln ja taikinakoukun kiinnitys/irrotus.

Kytt W Loukkaantumisvaara!

Kytke pistotulppa pistorasiaan vasta sitten, kun kaikki valmistelut koneella tyskentely varten on tehty. Huomio! Kyt konetta vain, kun lisvaruste/varuste on kyttasennossaan. l kynnist konetta ilman varustetta. l altista konetta ja varustetta lmmnlhteille. Osat eivt sovellu kytettviksi mikroaaltouunissa.

Puhdista laite ja varusteet huolellisesti ennen ensimmist kyttkertaa, katso kappale Puhdistus ja hoito.

Esivalmistelut Aseta peruslaite tasaiselle ja puhtaalle

alustalle. Ved yhdell vedolla liitntjohtoa ulos

haluamasi mr (enint. 100 cm) ja pst johto hitaasti irti; johto lukittuu (kuva C).

Jos johto on liian pitk: Ved kevyesti johdosta ja anna sen kelautua takaisin, kunnes pituus on sopiva. Ved sitten uudelleen johdosta ja pst hitaasti irti; johto lukittuu.

Huomio! Jos johto juuttuu kiinni, ved se kokonaan ulos ja anna sen sitten kelautua paikalleen.

Liit pistoke pistorasiaan.

Kulho ja varusteet Huomioi taulukossa annettavat kyttesimerkit. L

W Varo pyrivi varusteita loukkaantumisvaara! l tartu kulhoon laitteen ollessa toiminnassa. Muista aina laittaa kansi (12) kulhon plle kytn aikana! Vaihda varuste vain, kun kyttakseli on pyshtynyt akseli liikkuu viel jonkin aikaa pysyttmisen jlkeen ja pyshtyy varusteiden vaihtoasentoon. Siirr varsi toiseen asentoon vasta sitten, kun varuste on pyshtynyt. Aseta aina suojakannet niiden kyttliitntjen plle, jotka ei ole kytss. Huomio! Kyt kulhoa vain tmn laitteen kanssa. Vispil Profi Flexi (13) Sekoittaa taikinat, esim. kakkutai kinan, hedelmkakkutaikinan jne. ja sekoittaa joukkoon ainekset kuten rusinat ja suklaarouheen

108

fi Kytt

Pallovispil Profi (14) Vatkaa valkuaisvaahdon ja kerman (rasvapitoisuus vhintn 30 %) sek sokerikakkutaikinan Taikinakoukku (15) Vaivaa esim. hiivataikinan, leiptaikinan, pizzataikinan, nuu delitaikinan, pikkuleiptaikinan ja sekoittaa joukkoon esim. siementen kalta iset ainekset Trke pallovispiln kyttn liittyv ohje (kuva D): Pallovispiln on lhes kosketettava kulhon pohjaa, jotta ainekset sekoittuvat optimaalisesti. Jollei, niin sd pallovispiln korkeus seuraavasti:

Irrota pistoke pistorasiasta. Paina avaamispainiketta ja

knn varsi asentoon 2. Napsauta pallovispil kiinni

kyttliitntn. Pid kiinni pallovispilst ja avaa mutteri

kntmll sit kiintoavaimella (koko 8) mytpivn.

Sd pallovispiln korkeus sopivaksi kntmll vispil: Mytpivn: ylspin Vastapivn: alaspin

Paina avaamispainiketta ja knn varsi asentoon 1.

Tarkista pallovispiln korkeus, korjaa tarvittaessa.

Kun korkeus on sdetty oikein, paina avaamispainiketta ja knn varsi asentoon 2.

Pid kiinni pallovispilst ja kirist mutteri kntmll sit kiintoa vaimella (koko 8) vastapivn.

Kulhon ja varusteiden kytt (kuva E): Paina avaamispainiketta ja

knn varsi asentoon 2. Aseta kulho paikalleen:

Kallista kulhoa eteenpin, aseta se paikalleen ja knn vastapivn, kunnes se lukittuu kiinni.

Kiinnit kytttarkoitukseen sopiva varuste vispil, pallovispil tai taikinakoukku niin, ett se lukittuu kyttliitntn.

Huomautus: Knn taikinakoukun taikinanohjainta, kunnes taikinakoukku pystyy lukkiutumaan (kuva E4b).

Tyt ainekset kulhoon. Paina avaamispainiketta ja

knn varsi asentoon 1. Laita kansi paikalleen. Valitse haluamasi teho

valitsimella. Ainesten lisminen

Pysyt kone valitsimesta. Lis ainekset kannessa olevan

tyttaukon kautta. tai

Ota kansi pois. Paina avaamispainiketta ja

knn varsi asentoon 2. Tyt ainekset.

Kytn jlkeen Pysyt kone valitsimesta. Irrota pistoke pistorasiasta. Ota kansi pois. Paina avaamispainiketta ja

knn varsi asentoon 2. Irrota varuste kyttliitnnst. Poista kulho. Puhdista kaikki osat, katso kohta

Puhdistus ja hoito.

Vihannesleikkuri Huomioi taulukossa annettavat kyttesimerkit. M

W Loukkaantumisvaara! l koske hienonnusterien terviin teriin tai syrjiin. Tartu hienonnusteriin vain tern reunasta! Kiinnit ja irrota vihannesleikkuri vain, kun kyttakseli on pyshtynyt ja pistotulppa irrotettu pistorasiasta. l laita sormia tyttsuppiloon.

109

fiKytt

Huomio! Kyt vihannesleikkuria vain, kun sen kaikki osat ovat paikoilleen kiinnitettyin. Kokoa ensin vihannesleikkuri ja kiinnit se vasta sitten peruslaitteeseen. Kyt vihannesleikkuria vain ilmoitetussa kyttasennossa. Ylikuormitussuoja Kuva F: Kyttakselissa on lovi (murtumiskohta), joka suojaa laitetta suuremmilta vahingoilta vihannesleikkurin ylikuormittuessa. Kyttakseli murtuu tst kohtaa ylikuormituksessa. Uuden ternpitimen ja kyttakselin voit tilata huoltopalvelusta. Knnettv viipalointiter Profi Supercut paksu / ohut Leikkaa elintarvikkeet, esim. hedelmt ja vihannekset paksuiksi tai ohuiksi viipaleiksi. Merkint:

Karkea = paksut viipaleet Hieno = ohuet viipaleet

Huomautus: Ei sovellu kovan juuston, leivn, smpyliden tai suklaan viipalointiin. Vinkki: Viipaloi keitetyt perunat vasta, kun ne ovat jhtyneet. Knnettv raastinter karkea/hieno Raastaa elintarvikkeet, esim. hedelmt, vihannekset tai juuston kuten goudan tai edamjuuston karkeaksi tai hienoksi raasteeksi. Merkint:

2 = karkea puoli 4 = hieno puoli

Huomautus: Ei sovellu phkiniden tai kovan juuston, esim. parmesaanin rouhimiseen. Vinkki: Raasta pehme juustoa tern kar kealla puolella. Raasteter hieno Tekee hienoa raastetta esim. phkinist tai kovasta juustosta, esim. parmesaanista. Huomautus: Ei sovellu pehmen juuston tai juustoviipaleiden ksittelyyn.

Knnettv viipalointi- ja raastinter Raastaa tai viipaloi raaat perunat. Huomautus: Ei sovellu hyvin sikeisten elintarvikkeiden, esim. purjon tai mangon ksittelyyn. Vihannesleikkurin kytt Kuva G:

Paina avaamispainiketta ja knn varsi asentoon 2.

Aseta kulho paikalleen: Kallista kulhoa eteenpin, aseta se paikalleen ja knn vastapivn, kunnes se lukittuu kiinni.

Paina avaamispainiketta ja knn varsi asentoon 3.

Irrota vihannesleikkurin kyttlii tnnn suojakansi (kuva G5a).

Pid kiinni ternpitimen alaosasta, samalla molempien krkiosien tulee olla ylspin.

Aseta haluamasi viipalointi tai raastinter varovasti paikalleen ternpitimen krkiosien plle (kuva G6a). Kun kytt knnettv ter, varmista ett tarvitsemasi kyttpuoli on ylspin.

Tartu ternpitimeen sen ylpst ja aseta paikalleen runkoon (kuva G6b).

Aseta kansi paikoilleen (huomioi merkint) ja knn mytpivn vasteeseen asti.

Aseta vihannesleikkuri kyttliitnnn plle kuten kuvassa G8 ja knn mytpivn vasteeseen asti.

Valitse suositeltu nopeus. Laita ainekset tyttsuppiloon ja tynn

niit sisnpin syttpainimella. Huomio! Varo, ett hienonnettavat ainekset eivt kasaannu poistoaukkoon. Vinkki: Kun hienonnettavat ainekset ovat ohuita, ksittele ne nipuittain, niin saat tasaisemman lopputuloksen.

110

fi Kytt

Huomautus: Jos ainekset juuttuvat kiinni vihannesleikkuriin, katkaise virta yleiskoneesta, irrota pistoke pistorasiasta, odota ett kyttakseli pyshtyy, poista vihannesleikkurin kansi ja tyhjenn tyttsuppilo. Kytn jlkeen

Pysyt kone valitsimesta. Knn vihannesleikkuria vastapivn

ja irrota. Irrota kansi vastapivn knten. Poista ternpidin ja ter. painamalla

sormella kyttakselia vasten alhaaltapin (kuva H).

Puhdista osat.

Tehosekoitin Huomioi taulukossa annettavat kyttesimerkit N

W Varo tervi teri/pyriv kyttliitnt loukkaantumisvaara! l koske paikalleen kiinnitetyn tehosekoittimen sislle! Irrota/kiinnit tehosekoitin vain, kun kyttakseli on pyshtynyt! Kyt tehosekoitinta vain, kun sen kaikki osat ovat kiinnitettyin ja kansi on paikallaan. l kyt tehosekoitinta tyhjn.

W Palovamman vaara! Kannessa olevan suppilon kautta tulee ulos hyry, kun sekoitetaan kuumia aineksia. Tehosekoittimen kytt Kuva J:

Paina avaamispainiketta ja knn varsi asentoon 4.

Poista tehosekoittimen kyttliitnnn suojakansi.

Aseta tehosekoittimen kulho paikoilleen (kahvan merkki ja peruslaitteen merkki kohdakkain) ja knn vastapivn vasteeseen asti.

Tyt ainekset. Maksimimr nesteit = 1,25 litraa; maksimimr vaahtoavia tai kuumia nesteit = 0,75 litraa.

Aseta kansi paikalleen ja knn vastapivn tehosekoittimen kahvassa olevaan vasteeseen asti. Kannen tulee lukittua kiinni.

Valitse haluamasi teho valitsimella. Ainesten lisminen Kuva J-8:

Pysyt kone valitsimesta. Irrota kansi ja lis ainekset

tai poista suppilo ja lis kiintet ainekset

vhitellen tyttaukon kautta tai

kaada nestemiset ainekset kulhoon suppilon lpi.

Kytn jlkeen Pysyt kone valitsimesta. Irrota tehosekoitin mytpivn

knten. Vihje: Puhdista tehosekoitin heti kytn jlkeen.

W Huomio! Tarkoitukseen sopimattomat elintarvikkeet voivat vaurioittaa laitetta.

l ksittele sekoituskulhossa kuumia elintarvikkeita, joiden lmptila on yli 70 C.

l ksittele pakasteita, paitsi jpaloja, jos ne on sekoitettu riittvn mrn nestett.

l ksittele elintarvikkeita, jotka sisl tvt kovia aineksia. Kun hedelmiss (esim. omenat, persikat jne.) on sieme ni tai kivi, poista ne ennen hedelmien ksittely.

Huomautuksia Kytn rajoitukset:

l hienonna aineksia kuten manteleita, sipuleita, persiljaa tai lihaa.

Sekoittimella ei voi valmistaa levitteit kuten maaphkinvoita, kookosphkin voita tai phkinsosetta.

Sekoita kiintet elintarvikkeet riittvn nestemrn.

111

fiPuhdistus ja hoito

Sekoita jauhemaiset elintarvikkeet riittvn nestemrn tai liuota ne kokonaan nesteeseen ennen kuin aloitat sekoittamisen. Jauhemaisia elintarvikkeita ovat esim. tomusokeri, kaakaojauhe, paahdetut soijapavut, jauhot, valkuaisjauhe.

Puhdistus ja hoito Varusteet on puhdistettava huolellisesti aina kytn jlkeen. X Taulukko O Huomio! l kyt hankaavia puhdistusaineita. Laitteen pinnat voivat vaurioitua.

Peruslaitteen puhdistus W Shkiskun vaara!

l upota peruslaitetta veteen tai pese sit juoksevan veden alla. l kyt hyrypuhdistinta.

Irrota pistoke pistorasiasta. Pyyhi peruslaite ja kyttliitnnn

suojakansi puhtaaksi kostealla liinalla. Kyt tarvittaessa hieman ksinpesuun tarkoitettua astianpesuainetta.

Kuivaa laite lopuksi.

Kulhon ja varusteiden puhdistus Kulho ja varusteet voit pest astianpesu koneessa. Varo, ett muoviosat eivt j puristuksiin astianpesukoneessa, niiden muoto saattaa muuttua pesun aikana!

Vihannesleikkurin puhdistus W Varo terv ter loukkaantumisvaara!

l koske hienonnusterien terviin teriin tai syrjiin. Kyt puhdistamiseen harjaa. Voit pest vihannesleikkurin kaikki osat astianpesukoneessa. Vihje: Esimerkiksi raastetuista porkkanoista lhtee punaista vri, jonka voit pyyhki pois vihannesleikkurista (ei hienonnuste rist) liinalla ja muutamalla tipalla ruokal jy. Huuhtele sitten vihannesleikkuri.

Tehosekoittimen puhdistus W Varo terv ter

loukkaantumisvaara! l koske tehosekoittimen tern paljain ksin. Tehosekoittimen kulhon, kannen ja suppilon voi pest astianpesukoneessa. Vinkki: Nesteiden ksittelyn jlkeen voit usein puhdistaa tehosekoittimen irrotta matta sit laitteesta. Kaada koneeseen kiinnitettyyn sekoittimeen 700 ml vett, johon on listty ksinpesuun tarkoitettua astianpesuainetta. Kynnist tehosekoitin noin 1 minuutiksi (nopeu della 7). Kaada pesuvesi pois ja huuhtele tehosekoitin puhtaalla vedell. Trke ohje: Puhdista tarvittaessa varustelaukku. Noudata laukussa olevia puhdistusohjeita.

Silytys W Loukkaantumisvaara!

Kun et kyt konetta, irrota pistoke pistorasiasta. Kuva K:

Silyt varusteita ja hienonnusteri varustelaukussa.

Silyt varustelaukkua kulhossa.

Toimenpiteit kytthiriiden varalle

W Loukkaantumisvaara! Irrota pistoke pistorasiasta ennen hirin poistamista. Trke ohje: Jos kytt laitetta vrin, elektroninen turvakytkin laukeaa tai laitteeseen tulee vika, toiminnan nytn valo alkaa vilkkua. Kntyvn varren tulee aina lukittua kyttasentoon. Yrit poistaa hiri ensin seuraavien ohjeiden avulla. Hiri Laite ei kynnisty.

112

fi Kyttesimerkkej

Toimenpide Tarkista virransaanti. Tarkista pistoke. Tarkista varsi. Onko asento oikea?

Onko se lukittunut kiinni? Knn tehosekoitin tai kulho vastee

seen asti. Aseta tehosekoittimen kansi paikalleen

ja knn vasteeseen asti. Kiinnit suojakansi kyttmttmien

kyttliitntjen plle. Uudelleenkynnistysmissuoja on akti

voitunut. Aseta valitsin asentoon 0/off ja sitten takaisin haluamaasi asentoon.

Hiri Kone kytkeytyy kytn aikana pois plt. Ylikuormitussuoja on aktivoitunut. Ksiteltvi aineksia oli liian paljon. Toimenpide

Kytke laite pois plt. Pienenn ksiteltvien ainesten

mr. Hiri Kytn aikana painettiin vahingossa avaamispainiketta. Varsi kntyy yls. Kyttakseli kytkeytyy pois plt, mutta laite ei pyshdy varusteiden vaihtoasentoon. Toimenpide

Aseta valitsin asentoon 0/off. Aseta varsi asentoon 1. Kynnist laite (teho 1). Kytke laite jlleen pois plt.

Varuste pyshtyy varusteiden vaihtoasentoon. Hiri Tehosekoitin ei toimi tai pyshtyy kytn aikana, moottori hurisee. Ter on jumittunut. Toimenpide

Kytke laite pois plt ja irrota pistoke pistorasiasta.

Irrota tehosekoitin ja poista este. Aseta tehosekoitin takaisin paikalleen. Kytke laite plle.

Trke ohje Jos hiri ei poistu annettujen ohjeiden avulla, knny valtuutetun huoltopalvelun puoleen.

Kyttesimerkkej Noudata taulukoissa L, M ja N annettavia yleisi suosituksia. l ylit maksimimri.

Sokerikakkutaikina Perusohje 2 munaa 23 rkl kuumaa vett 100 g sokeria 1 tl vaniljasokeria 70 g jauhoja 70 g trkkelysjauhoa mahd. leivinjauhetta Vatkaa ainekset (paitsi jauhot ja

perunajauho) pallovispilll vaahdoksi noin 46 minuutin ajan nopeudella 7.

Knn valitsin asentoon 1 ja lis siivilidyt jauhot ja perunajauho lusikka kerrallaan ja sekoita noin 1 minuuttia.

Maksimimr: 2 x perusohje

Kakkutaikina Perusohje 6 kananmunaa 500 g sokeria 1 ripaus suolaa 2 pussia (= 4 tl) vaniljasokeria tai

sitruunan raastettu kuori 500 g voita tai margariinia

(huoneenlmpist) 1000 g jauhoja 1 pussi (= 2 rkl) leivinjauhetta 250 ml maitoa Sekoita kananmunia, sokeria, suolaa

ja vaniljasokeria tai sitruunankuorta n. 10 sekuntia vispiln nopeudella 1.

Aseta nopeudeksi 5 ja sekoita n. 120 sekuntia.

Lis voi ja sekoita n. 60 sekuntia nopeudella 3.

Lis jauhot ja leivinjauhe ja sekoita n. 2 minuuttia nopeudella 1.

113

fiKyttesimerkkej

Aseta nopeudeksi 3 ja lis maito vhi tellen 2 minuutin kuluessa.

Maksimimr: 1 x perusohje

Mehev hedelmkakku Perusohje 3 kananmunaa 135 g sokeria 135 g margariinia 255 g jauhoja 10 g leivinjauhetta 150 g korintteja 150 g kuivattuja sekahedelmi Kiinnit vispil. Lis kulhoon kaikki muut ainekset

paitsi kuivatut hedelmt. Ksittele 30 sekuntia nopeudella 1. Ksittele sitten 35 minuuttia

nopeudella 5. Valitse nopeus 2. Lis kuivatut hedelmt 3060 sekunnin

kuluessa. Maksimimr: 2 x perusohje

Murotaikina Perusohje 125 g voita

(huoneenlmpist) 100125 g sokeria 1 muna ripaus suolaa hieman sitruunankuorta tai

vaniljasokeria 250 g jauhoja mahd. leivinjauhetta Vatkaa vispilll kaikkia aineksia noin

minuuttia nopeudella 1, sitten noin 36 minuuttia nopeudella 3.

250 g jauhoja tai enemmn: Vaivaa aineksia taikinakoukulla noin

minuuttia nopeudella 1, sitten noin 56 minuuttia nopeudella 3.

Maksimimr: 2 x perusohje

Hiivataikina Perusohje 500 g jauhoja 1 muna 80 g rasvaa (huoneenlmpist)

80 g sokeria 200250 ml haaleaa maitoa 25 g hiivaa tai vastaava mr

kuivahiivaa sitruunan kuori ripaus suolaa Vaivaa taikinakoukulla kaikkia aineksia

noin minuuttia nopeudella 1, sitten noin 36 minuuttia nopeudella 3.

Maksimimr: 2 x perusohje

Pastataikina Perusohje 300 g jauhoja 3 munaa tarpeen mukaan 12 rkl (1020 g)

kylm vett Vaivaa kaikki ainekset taikinaksi noin

35 minuutin ajan nopeudella 3. Maksimimr: 1,5 x perusohje

Leiptaikina Perusohje 1000 g jauhoja 2 pussillinen kuivahiivaa 2 tl suolaa 600650 ml lmmint vett Vaivaa taikinakoukulla kaikkia aineksia

noin minuuttia nopeudella 1, sitten noin 67 minuuttia nopeudella 3.

Majoneesi 1 kananmuna 1 tl sinappia l ljy 1 rkl etikkaa tai sitruunamehua 1 ripaus suolaa 1 ripaus sokeria

Ainesten tytyy olla huoneenlmpisi. Majoneesi voidaan valmistaa vain kokonai sista kananmunista.

Sekoita kaikkia aineksia (paitsi ljy) tehosekoittimessa muutama sekunti nopeudella 3 tai 4.

Kytke tehosekoitin nopeudelle 7 ja kaada ljy hitaasti suppilon kautta ja sekoita niin kauan, kunnes majoneesi emulgoituu.

Kyt majoneesi tuoreena, l silyt.

114

fi Lisvarusteet

Lisvarusteet Varusteita voit ostaa huoltopalvelusta, alan liikkeist tai Internetin kautta. Kyt vain alkuperisi varusteita, koska ne sopivat tarkasti laitteeseen. Varusteet ovat laitekohtaisia. Ilmoita ostaessasi aina laitteesi tarkka mallinumero (ENr.). Tiedot laitteeseesi sopivista varusteista lydt esitteestmme, verkkokaupasta tai huoltopalvelusta. www.bosch-home.com

Jtehuolto

J Hvit pakkaus ympristystvl- lisesti. Tmn laitteen merkint perustuu kytettyj shk- ja elektroniikkalaitteita (waste electrical and electronic equipment WEEE) koskevaan direktiiviin 2012/19/EU. Tm direktiivi mritt kytettyjen laitteiden palautus- ja kierrtys-sn- nkset koko EU:n alueella. Tietoja oikeasta jtehuollosta saa myyjlt tai kunnalliselta jteneuvojalta.

Takuu Tlle laitteelle ovat voimassa maahantuojan myntmt takuuehdot. Tydelliset takuue- hdot saat myyntiliikkeelt, josta olet ostanut laitteen. Takuutapauksessa on nytettv ostokuitti.

Oikeus muutoksiin pidtetn.

115

esUso conforme a lo prescrito

Uso conforme a lo prescrito Este aparato ha sido diseado exclusivamente para uso domstico. No sobrepasar las cantidades a elaborar y los tiempos de funcionamiento habituales para uso domstico. El aparato ha sido diseado para mezclar, amasar y batir alimentos. El aparato no deber usarse para procesar otros tipos de alimentos o productos. Siempre que se empleen los accesorios especficos homologados por el fabricante, el aparato podr usarse para otras aplicaciones adicionales. Utilizar el aparato solo con piezas y accesorios originales autorizados. No utilizar nunca los accesorios para otros aparatos. Utilizar el aparato slo en recintos interiores y a temperatura ambiente y no utilizarlo por encima de los 2000 m sobre el nivel del mar.

Indicaciones de seguridad importantes Lea detenidamente las instrucciones de uso del aparato y gurdelas para una posible consulta posterior. No olvide adjuntar estas instrucciones si entrega el aparato a otra persona. El fabricante no asume ninguna responsabilidad por posibles daos resultantes del incumplimiento de las instrucciones relativas al uso correcto del aparato. Este aparato puede ser manejado por personas con facultades fsicas, sensoriales o mentales disminuidas o bien con falta de experiencia y/o de conocimientos, si lo hacen bajo supervisin o han sido instruidas acerca del uso seguro del aparato y han comprendido los peligros resultantes de ello. Los nios deben mantenerse alejados del aparato y del cable de alimentacin, y adems no deben manejar el aparato. Impida que los nios jueguen con el aparato. La limpieza y el mantenimiento a cargo del usuario no deben ser realizados por nios.

W Peligro de electrocucin y de incendio! Conectar y usar el aparato nicamente de acuerdo con las

indicaciones especificadas en la placa de caractersticas del modelo. No utilizar el aparato en caso de que el cable de conexin o el propio aparato presenten daos visibles. Para evitar riesgos, el aparato solo debe ser reparado (p. ej., cambio de un cable de alimentacin daado) por nuestro servicio de asistencia tcnica.

Conectar o desconectar el aparato exclusivamente a travs del mando giratorio. No conectar nunca el aparato a temporizadores ni enchufes teledirigidos. Vigilar siempre el aparato mientras est funcionando!

116

es Indicaciones de seguridad importantes

No colocar el aparato sobre o cerca de superficies calientes, como p. ej. placas elctricas. Evitar que el cable de conexin del aparato entre en contacto con piezas calientes y cantos afilados.

No sumergir nunca la base motriz en agua ni lavarla en el lavavajillas. No utilizar limpiadoras de vapor! No usar el aparato con las manos hmedas.

El aparato debe desconectarse siempre de la red elctrica despus de cada uso, cuando se vaya a dejar sin vigilancia, antes del montaje, desmontaje o limpieza y en caso de avera. W Peligro de lesiones!

Antes de cambiar accesorios o piezas adicionales que se muevan durante el funcionamiento, apagar el aparato y desconectarlo de la red elctrica. Tras desconectar el aparato, el accionamiento del mismo contina girando durante unos instantes. Esperar a que el accionamiento se detenga completamente.

No modificar la posicin del brazo giratorio con el aparato en funcionamiento.

Utilizar las herramientas solo si el recipiente est montado y tapado y las tapas de proteccin de los accionamientos estn colocadas! Al utilizar accesorios, colocar el recipiente, la tapa y las tapas protectoras de los accionamientos siguiendo las indicaciones!

No introducir nunca las manos en el recipiente o en la boca de llenado mientras el aparato est en funcionamiento. No introducir ningn objeto (p. ej. cuchara) en el recipiente o en la boca de llenado. Mantener las manos, el cabello, la ropa y otros utensilios alejados de las piezas giratorias.

No utilizar nunca herramientas y accesorios o 2 accesorios al mismo tiempo. En caso de usar los accesorios especficos, adems de estas instrucciones debern tenerse en cuenta las instrucciones de uso especficas de los accesorios.

Usar el accesorio solo completamente armado! No armar nunca el accesorio sobre la base motriz. Utilizar el accesorio nicamente en la posicin de trabajo prevista para ello.

No tocar ni manipular nunca con las manos las cuchillas ni los discos picadores. Sujetar las cuchillas picadoras slo por el borde!

No tocar ni manipular nunca las cuchillas con las manos. No introducir nunca las manos en la jarra batidora montada!

No poner en marcha la jarra batidora sin su tapa. Tenga cuidado al manipular las cuchillas afiladas, al vaciar el

recipiente y durante la limpieza.

117

esIndicaciones de seguridad importantes

W Peligro de quemaduras! Al elaborar alimentos o lquidos calientes en la batidora, puede escapar vapor caliente a travs del embudo en la tapa.

W Peligro de asfixia! No permita que los nios jueguen con el embalaje.

W Atencin! Se aconseja dejar el aparato conectado slo el tiempo absolutamente indispensable para elaborar los alimentos. No usar el aparato en seco, sin alimentos.

W Importante! Es imprescindible limpiar en profundidad el aparato despus de cada uso y despus de que no se haya utilizado durante un tiempo prolongado (X Cuidados y limpieza vase la pgina 123).

W Explicacin de los smbolos en el aparato o los accesorio

i Obsrvense estrictamente las instrucciones de uso!

Y Atencin! Cuchillas giratorias.

W Atencin! Accesorios giratorios! No introducir las manos en la abertura para incorporar ingredientes.

Enhorabuena por la compra de su nuevo aparato de la casa Bosch. En nuestra pgina web encontrar ms informacin sobre nuestros productos.

Contenido Uso conforme a lo prescrito.................... 115 Indicaciones de seguridad importantes .. 115 Sistemas de seguridad ........................... 117 Descripcin del aparato .......................... 118 Posiciones de trabajo ............................. 119 Usar del aparato ..................................... 119 Cuidados y limpieza ...............................123 Guardar el aparato .................................124 Localizacin de averas ..........................124 Ejemplos prcticos ................................125 Accesorios opcionales ............................127 Eliminacin .............................................127 Garanta..................................................127

Sistemas de seguridad Dispositivo de seguridad de conexin Vase la tabla Posiciones de trabajo En las posiciones 1 y 3, el aparato slo se puede conectar:

si el recipiente de mezcla (11) est colo cado en la mquina y se ha encajado girndolo.

Proteccin contra puesta en marcha fortuita En caso de corte o interrupcin del suministro de corriente, el aparato permanece conectado, aunque el motor no vuelve a ponerse en marcha. Para volver a conectar el aparato, girar el mando a la posicin 0/off.

118

es Descripcin del aparato

Seguro contra sobrecarga Si el motor se desconecta automticamente durante el uso, la proteccin contra sobrecarga est activada. Una posible causa puede ser la elaboracin de una excesiva cantidad de alimentos. Para conocer los detalles sobre el comportamiento del aparato en caso de activarse uno de los sistemas de seguridad, deber consultarse el captulo Localizacin de averas. El aparato no requiere mantenimiento.

Descripcin del aparato Figura A: Base motriz 1 Tecla de desbloqueo 2 Brazo giratorio

Funcin Easy Armlift para facilitar la elevacin del brazo giratorio (vase el apartado Posiciones de trabajo.

3 Mando giratorio Tras colocar el mando en la posicin de desconexin (0/off), el aparato ajusta automticamente la posicin ptima para cambiar los accesorios. 0/off = Parada M = Accionamiento momentneo (permite trabajar con el mximo nmero de revoluciones; hay que mantenerlo accionado con la mano). Nivel 1-7, velocidad de trabajo: 1 = velocidad baja lento, 7 = velocidad alta rpido.

4 Indicador de funcionamiento Se ilumina durante el funcionamiento del aparato (mando giratorio en M o 17). Parpadea en caso de un error en el manejo del aparato, al dispararse el fusible electrnico o en caso de registrarse una avera en el aparato; vase al respecto el captulo Localizacin de averas.

5 Tapa protectora del accionamiento Para retirar la tapa protectora del accionamiento, presionar sobre la parte posterior de la misma y retirarla.

6 Accionamiento para el cortador-rallador y el exprimidor de ctricos (accesorio opcional *). En caso de no utilizar estos accesorios, colocar siempre la tapa protectora sobre el accionamiento.

7 Accionamiento para los accesorios (varilla mezcladora, varilla batidora, garfio amasador) y la picadora (accesorio opcional *)

8 Tapa protectora del accionamiento de la jarra batidora

9 Accionamiento para batidora (accesorio especial*) En caso de no utilizar los accesorios, colocar siempre la tapa protectora sobre el accionamiento.

10 Recogecable automtico Recipiente de mezcla con accesorios 11 Recipiente de mezcla, de acero

inoxidable 12 Tapa Accesorios 13 Varilla mezcladora Profi Flexi 14 Varilla batidora profesional 15 Garfio amasador con separador de

masa 16 Bolsa para accesorios

Para guardar los accesorios y los discos picadores.

Cortador-rallador 17 Empujador 18 Tapa con boca de llenado 19 Discos picadores

a Disco reversible Profi Supercut (fino y grueso)

b Disco rallador reversible con dos grosores (fino y grueso)

c Disco rallador fino d Disco reversible para cortar y rallar*

20 Soporte portadiscos 21 Carcasa con abertura de descarga Batidora* 22 Vaso de la batidora 23 Tapa 24 Embudo

119

esPosiciones de trabajo

* En caso de que el equipo de serie de su aparato no incluyera un accesorio determinado, puede adquirirlo en el comercio especializado del ramo o solicitarlo al servicio de asistencia tcnica.

Posiciones de trabajo Figura B: Atencin! Usar el aparato slo con los accesorios colocados en el accionamiento prescrito y la posicin de trabajo correcta, de conformidad a la tabla adjunta. El brazo giratorio tiene que estar siempre enclavado, con indepen dencia de la posicin de trabajo que ocupe. Nota El brazo giratorio est equipado con la funcin Easy Armlift que facilita los movimientos de elevacin del mismo. Ajustar la posicin de trabajo:

Pulsar la tecla de desbloqueo y mover el brazo giratorio. Apoyar el movimiento con una mano.

Desplazar el brazo giratorio hasta hacerlo enclavar en la posicin de trabajo deseada.

Posicin Acciona- miento

Acceso- rios

Velocidad de trabajo

1 7

17

15

13

2 7 *

3 6 37

35

Posicin Acciona- miento

Acceso- rios

Velocidad de trabajo

4

9 57

7 57

* Montar/Desmontar la varilla batidora, la varilla mezcladora o el garfio amasador.

Usar del aparato W Peligro de lesiones!

Introducir el enchufe en la toma de corriente slo una vez concluidos todos los preparativos para trabajar con el aparato. Atencin! Usar el aparato slo con los accesorios en posicin de trabajo. No hacer funcionar el aparato en vaco! No exponer el aparato y sus accesorios a la accin de fuentes de calor. Las piezas no son aptas para emplear en el microondas.

Limpiar a fondo el aparato y los accesorios antes de usarlos por primera vez. Vase al respecto tambin el captulo Cuidados y limpieza.

Preparativos Colocar la base motriz sobre una

superficie lisa y limpia. Tirar del cable, una sola vez, hasta

alcanzar la longitud deseada (mxima longitud 100 cm) y soltarlo lentamente; el cable queda retenido en esta posicin (figura C).

Reducir la longitud del cable de conexin: Tirar ligeramente del cable y desenrollarlo hasta alcanzar la longitud de trabajo deseada. Volver a tirar ligera mente del cable y soltarlo lentamente; el cable queda retenido en esta posicin.

Atencin! En caso de que el cable se quede enganchado, extraerlo completamente de su alojamiento y enrollarlo.

Introducir el cable de conexin en la toma de corriente.

120

es Usar del aparato

Recipiente de mezcla y accesorios Tenga en cuenta los ejemplos de uso de la tabla. L

W Peligro de lesiones a causa de la rotacin de los accesorios! No introducir nunca las manos en el recipiente mientras est en funcionamiento el aparato! Trabajar slo con la tapa (12) colocada! Cambiar los accesorios slo con el accionamiento parado El aparato contina funcionando durante unos instantes tras desconectarlo y se detiene en la posicin para cambiar el accesorio! Mover el brazo giratorio slo una vez que se ha parado el accesorio usado. Cubrir siempre los accionamientos que no se utilicen con sus tapas protectoras. Atencin! Utilizar el recipiente de mezcla slo para elaborar alimentos con este aparato. Varilla mezcladora Profi Flexi (13) para preparar masas como, por ejemplo, masa de bizcocho, biz cocho de fruta, etc. y para mezclar ingre dientes como pasas y trocitos de chocolate Varilla batidora profesional (14) para montar la clara de huevo a punto de nieve, preparar nata (al menos un 30 % de grasa) o batir masa para galletas Garfio amasador (15) para amasar masas slidas, por ejemplo, masa de levadura, masa de pan, masa de pizza, masa de pasta, masa de repostera y para mezclar ingre dientes como semillas en la masa Advertencia importante para la utilizacin de la varilla batidora (figura D): La varilla batidora deber estar casi en contacto con el fondo del recipiente a fin de mezclar ptimamente todos los ingredientes. De lo contrario habr que adaptar el ajuste de altura de la varilla batidora procediendo del modo siguiente:

Extraiga el cable de conexin de la toma de corriente.

Pulsar la tecla de desbloqueo y colocar el brazo giratorio en la posicin 2.

Encajar la varilla batidora en el accionamiento correspondiente, hacindola enclavar en el mismo.

Sujetar la varilla batidora y soltar la tuerca girndola en sentido horario con una llave fija (ancho de boca 8).

Ajustar la altura correcta de la varilla girndola hasta alcanzar la altura ptima: girando en sentido horario se eleva; girando en sentido antihorario se baja

Pulsar la tecla de desbloqueo y colocar el brazo giratorio en la posicin 1.

Comprobar la altura de la varilla ajustada; corregirla en caso necesario.

En caso de que el ajuste de la altura de la varilla fuera correcto, pulsar la tecla de des bloqueo y colocar el brazo gira torio en la posicin 2.

Sujetar la varilla batidora y apretar la tuerca en sentido antihorario con una llave fija (ancho de boca 8).

Trabajar con el recipiente de mezcla y los accesorios (figura E):

Pulsar la tecla de desbloqueo y colocar el brazo giratorio en la posicin 2.

Colocar el recipiente: Colocar el recipiente, inclinado hacia delante, y despus asentarlo, girarlo en sentido antihorario hasta que encaje.

Montar el accesorio que vaya a utilizarse, varilla mezcladora, varilla batidora o garfio amasador, hacin dolo encajar hasta el tope en el accionamiento.

Nota: En la varilla de amasado, girar el separador de masa hasta que encaje la varilla en el accionamiento (figura E-4b).

Incorporar los ingredientes en el recipiente.

121

esUsar del aparato

Pulsar la tecla de desbloqueo y colocar el brazo giratorio en la posicin 1.

Colocar la tapa sobre el recipiente.

Colocar el mando giratorio en el nivel deseado.

Agregar o reponer ingredientes Desconectar el aparato a travs del

mando giratorio. Incorporar los ingredientes a travs de

la abertura de la tapa. o

Retirar la tapa. Pulsar la tecla de desbloqueo y

colocar el brazo giratorio en la posicin 2.

Poner los ingredientes en la jarra batidora.

Tras concluir el trabajo Desconectar el aparato a travs del

mando giratorio. Extraer el cable de conexin de la toma

de corriente. Retirar la tapa. Pulsar la tecla de desbloqueo y

colocar el brazo giratorio en la posicin 2.

Retirar el accesorio del accionamiento.

Retirar el recipiente del aparato. Limpiar todas las piezas y elementos.

Vase al respecto el captulo Cuidados y limpieza.

Cortador-rallador Tenga en cuenta los ejemplos de uso de la tabla. M

W Peligro de lesiones! No tocar ni manipular nunca con las manos las cuchillas afiladas ni cantos de los discos picadores. Sujetar los discos picadores slo por el borde! Colocar o retirar el corta dorrallador de la base motriz slo una vez que el accionamiento de sta se ha parado completamente y se haya extrado el cable de conexin de la toma de corriente. No introducir las manos en la boca de llenado.

Atencin! Utilizar el cortadorrallador slo si est completamente armado. No armar el cortadorrallador directamente sobre la base motriz. Usar el cortadorrallador slo en la posicin de trabajo mostrada. Proteccin contra sobrecarga Figura F: Con objeto de evitar daos importantes en su aparato en caso de sobrecarga del cortadorrallador, el eje de accionamiento de ste incorpora una entalladura (punto de ruptura prescrito). En caso de producirse una sobrecarga del cortadorrallador, el eje de accionamiento se rompe en este punto. El soporte portadiscos con eje nuevo se puede adquirir en el servicio de asistencia tcnica. Disco reversible Profi Super- cut grueso / fino para cortar frutar y verdura. Procesar en el nivel 5. Denominacin en el disco reversible para picar y cortar: Grueso designa la cara ms gruesa Fino designa la cara ms fina Atencin! El disco reversible para cortar no es adecuada para cortar queso curado, pan, panecillos y chocolate. Cortar las patatas cocidas no harinosas slo en fro. Disco rallador reversible con dos grosores (fino y grueso) para rallar alimentos en trozos finos o gruesos (p. ej. frutas, verduras o quesos, como gouda o edam). Identificacin:

2 = parte gruesa 4 = parte fina

Nota: No adecuado para procesar nueces o queso duro (p. ej., queso parmesano). Consejo: Rallar el queso blando solo con la cara gruesa del disco. Disco rallador fino para rallar alimentos finos (p. ej. frutos secos o queso duro, como parmesano).

122

es Usar del aparato

Nota: No adecuado para procesar quesos blandos o queso en lonchas. Disco reversible para cortar y rallar para rallar patatas crudas o para cortar en rodajas. Nota: No adecuado para procesar alimen tos con fibra (p. ej. apio o puerro). Trabajar con el cortador-rallador Fig. G:

Pulsar la tecla de desbloqueo y colocar el brazo giratorio en la posicin 2.

Colocar el recipiente: Colocar el recipiente, inclinado hacia delante, y despus asentarlo, girarlo en sentido antihorario hasta que encaje.

Pulsar la tecla de desbloqueo y colocar el brazo giratorio en la posicin 3.

Retirar la tapa protectora del accionamiento del cortadorrallador (figura G-5a).

Sujetar el soporte portadiscos por el extremo inferior. Prestar atencin a que las dos puntas estn hacia arriba,.

Colocar cuidadosamente el disco picador o el disco rallador sobre las puntas del soporte portadiscos (figura G-6a). En los discos reversibles deber prestarse atencin a que la cara que se desea utilizar est hacia arriba.

Sujetar el soporte portadiscos por el extremo superior y colocarlo en la carcasa (figura G-6b).

Montar la tapa (teniendo en cuenta la marca) y girarla en sentido horario hasta el tope.

Colocar el cortadorrallador sobre el accionamiento, tal como se muestra en la figura G-8, y girarlo en sentido horario hasta el tope.

Colocar el mando giratorio en el nivel recomendado.

Introducir los alimentos que se desean procesar en la boca de carga y empujarlos con el empujador.

Atencin! Prestar atencin a que no se produzcan retenciones u obstrucciones de alimentos en la abertura de descarga. Consejo prctico: Para lograr un corte regular de los alimentos, cortar stos por manojos delgados. Nota: Si los alimentos se quedan atascados en el cortadorrallador, desconectar el robot de cocina, extraer el cable de conexin de la toma de corriente y esperar a que el accionamiento se haya detenido. A continuacin retirar la tapa del cortadorrallador y vaciar la boca de llenado. Tras concluir el trabajo

Desconectar el aparato a travs del mando giratorio.

Girar el cortadorrallador en sentido antihorario y retirarlo.

Girar la tapa en sentido antihorario y retirarla.

Retirar el soporte portadiscos y el disco. Para ello, presionar con el dedo contra el eje de transmisin desde abajo (figura H).

Limpiar las piezas.

Batidora Tenga en cuenta los ejemplos de uso de la tabla. N

W Peligro de lesiones a causa de las cuchillas cortantes/el accionamiento giratorio! No introducir nunca las manos en la batidora montada! Retirar o montar la batidora slo con el accionamiento parado. Trabajar siempre con la batidora completamente armada y la tapa colocada. No hacer funcionar la batidora en vaco.

W Peligro de quemaduras! Al elaborar alimentos o lquidos calientes en la batidora, puede escapar vapor caliente a travs del embudo en la tapa. Trabajar con la batidora Figura J:

Pulsar la tecla de desbloqueo y colocar el brazo giratorio en la posicin 4.

123

esCuidados y limpieza

Retirar la tapa protectora del accionamiento de la batidora.

Montar el vaso de la batidora (la marca en el asa de la jarra debe coincidir con la marca de la base motriz); girarla en sentido antihorario hasta el tope.

Poner los ingredientes en la jarra batidora. Cantidad mxima de lquido = 1,25 litros. Cantidad mxima de lquidos calientes o que producen espuma= 0,75 litros.

Montar la tapa en la jarra y girarla en sentido antihorario hasta el tope en el asa. La tapa tiene que estar enclavada.

Colocar el mando giratorio al nivel deseado.

Agregar o reponer ingredientes Figura J-8:

Desconectar el aparato a travs del mando giratorio.

Retirar la tapa e incorporar los ingredientes

o retirar el embudo y agregar los

ingredientes slidos a travs de la abertura

o agregar los ingredientes lquidos a

travs del embudo. Tras concluir el trabajo

Desconectar el aparato a travs del mando giratorio.

Retirar y extraer la batidora en sentido horario.

Consejo prctico: Limpiar la jarra directamente tras concluir su uso.

W Atencin! El aparato puede resultar daado si se utiliza para alimentos no apropiados.

No procesar alimentos calientes por encima de 70C en el vaso de la batidora.

No tratar de procesar alimentos conge lados, excepto cubitos de hielo si se han introducido en una cantidad suficiente de lquido.

No procesar alimentos que contengan elementos duros. Para procesar frutas con corazn o hueso (manzanas, melocotones, etc.) debern eliminarse previamente los corazones o huesos de la fruta.

Notas Limitaciones a la hora de la elaboracin:

no picar ingredientes como almendras, cebollas, perejil y carne.

La batidora no es capaz de elaborar productos para untar, como mantequilla de cacahuete, de coco o de nueces.

Mezclar los alimentos slidos con sufi ciente lquido.

Mezclar los alimentos en polvo con suficiente lquido antes de mezclarlos o disolverlos del todo en lquido. Por alimentos en polvo se entienden azcar glas, cacao en polvo, habas de soja tostadas, harina o protena en polvo, entre otros.

Cuidados y limpieza Limpiar bien todos los accesorios empleados despus de cada uso. X Tabla O Atencin! No emplear productos de limpieza abrasivos. Las superficies podran daarse.

Limpiar la base motriz W Peligro de descarga elctrica!

No sumergir nunca la base motriz en agua ni lavarla bajo el grifo de agua. No utilizar nunca una limpiadora de vapor.

Extraer el cable de conexin de la toma de corriente.

Limpiar la base motriz y las tapas protectoras slo con un pao hmedo. En caso necesario, agregar un poco de lavavajillas.

Secar la base motriz.

124

es Guardar el aparato

Limpiar el recipiente y los accesorios El recipiente y los accesorios pequeos se pueden lavar en el lavavajillas. Al colocar las piezas de plstico en el lavavajillas, prestar atencin a no aprisionarlas, de lo contrario podran sufrir deformaciones.

Limpiar el cortador-rallador W Peligro de lesiones a causa de las cuchillas cortantes!

No tocar ni manipular nunca con las manos las cuchillas ni los discos picadores. Usar siempre un cepillo para limpiar las cuchillas! Todas las piezas del cortadorrallador son aptas para el lavavajillas. Consejo prctico: Al rallar zanahorias o productos similares, se acumula sobre las piezas de plstico una capa de color rojizo. Esta capa se puede eliminar aplicando varias gotas de aceite de cocina y frotando con un pao el cortadorrallador (no los discos picadores!). Aclarar a continuacin el cortadorrallador con agua.

Limpiar la batidora W Peligro de lesiones a causa de las

cuchillas cortantes! No tocar ni manipular nunca las cuchillas directamente con las manos. La jarra, la tapa y el embudo son apropiados para el lavado en el lavavajillas. Consejo prctico: despus de procesar lquidos, muchas veces se puede limpiar la jarra batidora sin necesidad de retirarla de la base motriz. Simplemente basta con poner 700 ml de agua y con una gota de lavavajillas manual en la batidora montada en el aparato. Activar durante aprox. 1 minuto la batidora (posicin 7). Verter el agua al desage y enjuagar la jarra con agua limpia. Advertencia importante En caso necesario, limpiar la bolsa de los accesorios. Prestar atencin a los consejos de lavado y cuidado que figuran en la bolsa.

Guardar el aparato W Peligro de lesiones!

Extraer el cable de conexin de la toma de corriente en caso de no utilizar el aparato. Figura K:

Guardar los accesorios y los discos picadores en la bolsa de accesorios.

Guardar la bolsa en el recipiente de mezcla.

Localizacin de averas W Peligro de lesiones!

Antes de efectuar cualquier trabajo en el aparato, extraer el cable de conexin de la toma de corriente. Advertencia importante En caso de manejo errneo del aparato, dispararse el fusible electrnico o registrarse una avera en el aparato, el piloto de funcionamiento del aparato parpadea. El brazo giratorio tiene que estar siempre enclavado, con independencia de la posicin de trabajo que ocupe. Trate de solucionar primero el problema surgido con ayuda de los consejos que le facilitamos a continuacin. Avera El aparato no se pone en marcha. Solucin

Verificar la alimentacin de corriente. Verificar el enchufe del cable de cone

xin del aparato. Verificar el brazo giratorio.

Se encuentra en la posicin correcta? Est enclavado en su posicin?

Apretar la jarra batidora o el recipiente hasta el tope.

Montar la tapa de la jarra batidora y apretarla hasta el tope.

Colocar las tapas protectoras de los accionamientos sobre los accionamien tos que no se estn usando.

El seguro contra puesta en marcha fortuita est activado. Colocar el aparato en la posicin 0/off y a continuacin ajustar el nivel deseado.

125

esEjemplos prcticos

Avera El aparato se desconecta durante la marcha. La proteccin contra sobrecarga se ha activado. Se ha elaborado una cantidad excesiva de alimentos. Solucin

Desconectar el aparato. Elaborar una menor cantidad de

alimentos. Avera Durante el funcionamiento del accionamiento se puls accidentalmente la tecla de desbloqueo. El brazo giratorio se desplaza hacia arriba. El accionamiento se desconecta, pero no permanece en la posicin para cambio de accesorios. Solucin

Colocar el mando giratorio en la posi cin 0/off.

Colocar el brazo giratorio en la posicin de trabajo 1.

Conectar el aparato (nivel 1). Desconectar el aparato.

El accesorio permanece en la posicin para cambio de accesorio. Avera La batidora no se pone en marcha o se para de repente. El motor produce un murmullo sordo. Las cuchillas estn bloqueadas. Solucin

Desconectar el aparato y extraer el cable de conexin de la toma de corriente.

Retirar la jara batidora de la base motriz y eliminar el ingrediente responsable del bloqueo de la cuchilla.

Volver a colocar la jarra batidora sobre la base motriz.

Conectar el aparato. Advertencia importante En caso de no poder subsanar la avera con estos consejos, avisar al servicio de asistencia tcnica.

Ejemplos prcticos Tenga en cuenta las recomendaciones generales de las tablas L, M y N. No sobrepasar las cantidades mximas admisibles.

Masa de bizcocho Receta bsica 2 huevos 23 cucharadas soperas de

agua caliente 100 gramos de azcar 1 sobrecito de azcar de vainilla 70 gramos de harina 70 gramos de fcula de maz (maicena)

levadura en polvo Batir todos los ingredientes (excepto

la harina y la maicena) con la varilla batidora durante 46 minutos en la posicin de trabajo 7, hasta formar una masa esponjosa consistente.

Colocar el mando giratorio en la posicin 1 y agregar y mezclar la harina y la fcula de maz (previamente tamizadas) durante aprox. 1 minuto. agregndolas a cucharadas.

Mxima cantidad: 2 veces la receta bsica

Masa batida Receta bsica 6 huevos 500 g de azcar 1 pizca de sal 2 sobrecitos de azcar de vainilla o la

cscara limn 500 gramos de margarina o mantequilla

(temperatura ambiente) 1000 g de harina 1 sobrecito de levadura en polvo 250 ml de leche Batir los huevos, el azcar, la sal y

el azcar de vainilla o la cscara de limn durante unos 10 segundos con la batidora en el nivel 1.

Llevar al nivel 5 y batir durante aprox. 120 segundos.

Aadir la mantequilla y batir 60 segun dos en el nivel 3.

Aadir la harina y la levadura en polvo y batir unos 2 minutos en el nivel 1.

126

es Ejemplos prcticos

Pasar al nivel 3 y aadir poco a poco la leche durante 2 minutos.

Mxima cantidad: 1 x la receta bsica

Pudin de frutas deshidratadas Receta bsica 3 huevos 135 g de azcar 135 g de margarina 255 g de harina 10 g de impulsor 150 g de pasas de Corinto 150 g de mezcla de frutas

deshidratadas Montar la varilla mezcladora. Agregar todos los ingredientes excepto

las frutas deshidratadas. Procesar durante 30 segundos en la

posicin 1. A continuacin, batir 35 minutos en la

posicin 5. Ajustar la posicin 2. Aadir las frutas deshidratadas una vez

transcurridos 3060 segundos. Mxima cantidad: 2 receta bsica

Masa quebrada (pastaflora) Receta bsica 125 gramos de mantequilla

(temperatura ambiente) 100125 gramos de azcar 1 huevo 1 pizca de sal unas cscaras de limn

o un poco de azcar de vainilla 250 gramos de harina levadura en polvo Procesar todos los ingredientes con

la varilla mezcladora durante aprox. minuto en la posicin de trabajo 1 y, a continuacin, durante aprox. 36 minutos en la posicin de trabajo 3.

A partir de 250 gramos de harina: Amasar los ingredientes con el garfio de

amasador durante aprox. minuto en la posicin 1 y a continuacin, durante 56 minutos, en la posicin 3.

Mxima cantidad: 2 veces la receta bsica

Masa de levadura Receta bsica 500 gramos de harina 1 huevo 80 gramos de mantequilla

(temperatura ambiente) 80 gramos de azcar 200250 ml de leche tibia 25 gramos de levadura

o 1 paquetito de levadura seca Cscara de limn 1 pizca de sal Amasar todos los ingredientes con

el garfio amasador durante aprox. minuto en la posicin de trabajo 1 y a continuacin, durante aprox. 36 minutos, en la posicin de trabajo 3.

Mxima cantidad: 2 veces la receta bsica

Masa para pasta Receta bsica 300 gramos de harina 3 huevos 12 cucharadas soperas (1020 gramos)

de agua fra Batir todos los ingredientes durante

3 a 5 minutos en la posicin de trabajo 3, hasta formar una masa.

Mxima cantidad: 1,5 veces la receta bsica

Masa para pan Receta bsica 1000 g gramos de harina 2 paquetito de levadura seca 2 cucharillas de sal 600650 ml de agua templada Amasar todos los ingredientes con el

garfio amasador durante aprox. minuto en la posicin de trabajo 1 y a continuacin, durante aprox. 67 minutos, en la posicin de trabajo 3.

Mayonesa 1 huevo 1 cucharadita de mostaza l de aceite 1 cucharada sopera de zumo de limn

o vinagre 1 pizca de sal 1 pizca de azcar

127

esAccesorios opcionales

Los ingredientes deben estar siempre a temperatura ambiente. La mayonesa solo puede prepararse con huevos enteros.

Colocar el mando selector en la posi cin de trabajo 3 o 4. Mezclar todos los ingredientes (excepto el aceite) durante unos segundos en la jarra batidora en dicha posicin.

Colocar el mando en la posicin 7. Incorporar el aceite lentamente a travs del embudo. Proseguir batiendo la mayonesa e incorporando aceite, hasta que la mayonesa emulsione.

Consumir la mayonesa tras su elaboracin. No guardarla!

Accesorios opcionales Pueden adquirirse accesorios opcionales en el servicio de asistencia tcnica, en comercios especializados o en Internet. Utilice solo accesorios originales, ya que estn adaptados a la perfeccin a su aparato. Los accesorios son especficos de cada aparato. Al comprarlos, indique siempre la denominacin exacta (ENr.) de su aparato. La informacin relativa a los accesorios para su aparato est disponible en nuestro catlogo, a travs del servicio de asistencia tcnica o en la tienda en lnea. www.bosch-home.com

Eliminacin

J Elimine el embalaje respetando el medio ambiente. Este aparato est marcado con el smbolo de cum- plimiento con la Directiva Europea 2012/19/UE relativa a los aparatos elctricos y electrnicos usados (Residuos de aparatos elctricos y electrnicos RAEE). La directiva proporciona el marco general vlido en todo el mbito de la Unin Euro- pea para la retirada y la reutilizacin de los residuos de los aparatos elc- tricos y electrnicos. Infrmese sobre las vas de eliminacin actuales en su distribuidor.

Garanta Bosch se compromete a reparar o reponer de forma gratuita durante un perodo de 24 meses, a partir de la fecha de compra por el usuario final, las piezas cuyo defecto o falta de funcionamiento obedezca a causas de fabricacin, as como la mano de obra necesaria para su reparacin, siempre y cuando el aparato sea llevado por el usuario al taller del Servicio Tcnico Autorizado por Bosch. En el caso de que el usuario solicitara la visita del Tcnico Autorizado a su domicilio para la reparacin del aparato, estar obligado el usuario a pagar los gastos del desplazamiento. Esta garanta no incluye: lmparas, cristales, plsticos, ni piezas estticas, reclamadas despus del primer uso, ni averas produ- cidas por causas ajenas a la fabricacin o por uso no domstico. Igualmente no estn amparadas por esta garanta las averas o falta de funcionamiento producidas por cau- sas no imputables al aparato (manejo inade- cuado del mismo, limpiezas, voltajes e insta- lacin incorrecta) o falta de seguimiento de las instrucciones de funcionamiento y mante- nimiento que para cada aparato se incluyen en el folleto de instrucciones. Para la efectividad de esta garanta es imprescindible acreditar por parte del usua- rio y ante el Servicio Autorizado de Bosch, la fecha de adquisicin mediante la correspon- diente FACTURA DE COMPRA que el usua- rio acompaar con el aparato cuando ante la eventualidad de una avera lo tenga que lle- var al Taller Autorizado. La intervencin en el aparato por perso- nal ajeno al Servicio Tcnico Autorizado por Bosch, significa la prdida de garanta. GUARDE POR TANTO LA FACTURA DE COMPRA. Todos nuestros tcnicos van provistos del correspondiente carnet avalado por ANFEL (Asociacin Nacional de Fabricantes de Elec- trodomsticos) que le acredita como Servicio Autorizado de Bosch.

Reservado el derecho a cambios y modificaciones sin previo aviso.

128

pt Utilizao correta

Utilizao correta Este aparelho destinase exclusivamente a uso privado e domstico. Utilizar o aparelho somente para as quantidades e tempos de utilizao normais no uso domstico. O aparelho adequado para mexer, amassar e bater alimentos. O aparelho no pode ser utilizado para processar outros tipos de objetos ou substncias. So possveis aplicaes adicionais mediante utilizao de outros acessrios homologados pelo fabricante. Este aparelho s pode ser utilizado com peas e acessrios originais autorizados. Nunca utilizar os acessrios para outros aparelhos. Utilizar o aparelho apenas em espaos interiores temperatura ambiente e at 2000 m acima do nvel do mar.

Indicaes de segurana importantes Leia atentamente o manual de instrues, proceda em conformidade e guardeo! Se o aparelho mudar de proprietrio, estas instrues devem acompanhlo. A no observncia das indicaes sobre a utilizao correta do aparelho exclui uma responsabilidade do fabricante por danos da resultantes. Este aparelho pode ser utilizado por pessoas com capacidades fsicas, sensoriais ou mentais limitadas ou com falta de experincia e/ou conhecimentos, desde que supervisionadas ou informadas sobre como trabalhar com o aparelho de forma segura e instrudas sobre os perigos inerentes. O aparelho e o cabo eltrico devem ser mantidos fora do alcance de crianas. As crianas no podem brincar com o aparelho. As crianas no podem efetuar a limpeza e manuteno do aparelho.

W Perigo de choque eltrico e de incndio! Ligar e utilizar o aparelho apenas de acordo com as indicaes

da chapa de caractersticas. Utilizar o aparelho somente se o cabo de alimentao ou o prprio aparelho no apresentarem quaisquer danos. Reparaes no aparelho como, p. ex., a substituio de um cabo eltrico danificado, s podem ser efetuadas pelo nosso Servio de Assistncia Tcnica, para se evitarem situaes de perigo.

Ligar e desligar o aparelho exclusivamente com o selector. Nunca ligar o aparelho a relgios temporizadores ou a

tomadas telecomandadas. Vigiar sempre o aparelho durante o funcionamento!

129

ptIndicaes de segurana importantes

No colocar o aparelho sobre ou na proximidade de superfcies quentes, como por exemplo placas de fogo. No permitir que o cabo de alimentao toque em peas quentes nem o puxar sobre arestas vivas.

Nunca mergulhar o aparelho base em gua ou lavar na mquina de loia. Nunca utilizar aparelhos de limpeza a vapor. No utilizar o aparelho com as mos hmidas ou molhadas.

Desligar o aparelho da corrente aps cada utilizao, sempre que fique sem vigilncia, antes de se montar, desmontar ou limpar, e em caso de anomalia. W Perigo de ferimentos!

Antes de se trocar peas acessrias ou opcionais que se movimentam durante o funcionamento, tem de se desligar o aparelho e retirar a ficha da corrente. Depois de desligado, o acionamento ainda gira por breves instantes. Aguardar que o acionamento esteja completamente parado.

No alterar a posio do brao mvel enquanto o aparelho estiver ligado.

Utilizar as ferramentas apenas com a tigela, a tampa e a tampa de proteo do acionamento colocadas! Caso sejam utilizados acessrios, colocar a tigela, a tampa e a tampa de proteo do acionamento de acordo com as instrues!

Durante o funcionamento, nunca introduzir as mos na tigela nem no canal de enchimento. No introduzir objetos (p. ex., concha) na tigela nem no canal de enchimento. Manter as mos, os cabelos, o vesturio e outros utenslios afastados das peas em rotao.

Nunca utilizar ferramentas em simultneo com um ou 2 acessrios. Na utilizao dos acessrios, respeitar estas instrues de servio, bem como as instrues anexas.

S utilizar o acessrio em estado totalmente montado. Nunca montar o acessrio no aparelho base. S utilizar o acessrio na posio de trabalho prevista para o efeito.

No tocar nas lminas afiadas nem nas arestas do disco de picar. Segurar os discos de triturar apenas pelos bordos!

No tocar com as mos na lmina do misturador. Nunca segurar no misturador depois de este estar montado! Nunca

colocar o misturador em funcionamento sem a tampa colocada. Cuidado ao manusear as lminas afiadas durante o

esvaziamento do recipiente e durante a limpeza. W Perigo de queimaduras!

Ao trabalhar com produtos quentes, verificase uma passagem de vapor atravs do funil para a tampa.

130

pt Indicaes de segurana importantes

Muitos parabns por ter comprado um novo aparelho da marca Bosch. Na nossa pgina da Internet poder encontrar mais informaes sobre os nossos produtos.

ndice Utilizao correta ....................................128 Indicaes de segurana importantes ....128 Sistemas de segurana ..........................130 Panormica do aparelho ........................131 Posies de trabalho ..............................131 Utilizao ................................................132 Limpeza e manuteno ..........................136 Arrumao ..............................................137 Ajuda em caso de anomalia ...................137 Exemplos de utilizao ..........................138 Acessrios especiais ..............................139 Eliminao do aparelho ..........................140 Garantia ..................................................140

W Perigo de asfixia! No permitir que crianas brinquem com o material de embalagem.

W Ateno! Recomendase que o aparelho nunca fique ligado mais tempo do que o necessrio para a preparao dos alimentos. No utilizar em vazio.

W Importante! impretervel limpar cuidadosamente o aparelho aps cada utilizao ou aps um longo perodo de no utilizao (X Limpeza e manuteno ver pgina 136).

W Explicao dos smbolos no aparelho e nos acessrios

i Seguir as indicaes das Instrues de servio.

Y Cuidado! Lminas em rotao.

W Cuidado! Ferramentas em rotao. No tocar na abertura de enchimento.

Sistemas de segurana Proteo de ligao Ver tabela Posies de trabalho O aparelho s pode ser ligado na posio 1 e 3:

se a tigela (11) tiver sido colocada e rodada at prender.

Proteo contra ligao indevida Numa falha de corrente, o aparelho conti nua ligado, mas, depois disto, o motor no volta a arrancar. Para voltar a ligar, rodar o seletor para 0/off, e, depois, ligar.

Proteo contra sobrecarga Se, durante a utilizao, o motor se desligar sozinho, isso significa que foi ativada a proteo contra sobrecarga. Uma causa possvel pode ser a preparao simultnea de grande quantidade de alimentos. Como proceder na ativao de um sistema de segurana, ver Ajuda em caso de anomalias. O aparelho no carece de manuteno.

131

ptPanormica do aparelho

Panormica do aparelho Fig. A: Aparelho base 1 Boto de desbloqueio 2 Brao mvel

Funo de Easy Armlift para apoio do movimento ascendente do brao (ver Posies de trabalho).

3 Seletor Depois de desligar o aparelho (posio 0/off), ele muda automatica mente para a posio ideal para troca da ferramenta. 0/off = Parar M = Ligao instantnea com veloci dade mxima; no largar o seletor, se se pretender um funcionamento cont nuo do misturador. Fases 1-7, velocidade de funciona mento: 1 = velocidade reduzida lento, 7 = velocidade elevada rpido.

4 Indicao de funcionamento Est iluminada durante o funcionamento (seletor em M ou 1-7). Pisca em caso de erros na utilizao do aparelho, na ativao do dispositivo eletrnico de segurana ou de defeito no aparelho, ver captulo Ajuda em caso de anomalias.

5 Tampa de proteo do acionamento Para retirar a tampa de proteo do acionamento, pressionar a zona traseira e retirar a tampa.

6 Acionamento para dispositivo para cortar e ralar e espremedor de citrinos (Acessrio especial*). Em caso de no utilizao, aplicar a tampa de proteo do acionamento.

7 Acionamento para ferramentas (varas para massas leves e para bater claras em castelo, varas para massas pesadas) e picador de carne (Acessrio especial*)

8 Tampa de proteo do acionamento do misturador

9 Acionamento do misturador (Acessrio especial*)

Em caso de no utilizao, aplicar a tampa de proteo do acionamento.

10 Sistema automtico de enrolamento do cabo

Tigela com acessrios 11 Tigela em inox 12 Tampa Ferramentas 13 Vara para massas leves Profi Flexi 14 Vara para claras em castelo Profi 15 Vara para massas pesadas com

proteo para as massas 16 Bolsa de acessrios

Para arrumao das ferramentas e dos discos de picar.

Dispositivo para cortar e ralar 17 Calcador 18 Tampa com canal de enchimento 19 Discos de triturar

a Disco reversvel Profi Supercut grosso/fino

b Disco reversvel de ralar grosso/fino

c Disco de raspar fino d Disco reversvel de cortar/ralar*

20 Suporte de discos 21 Estrutura com abertura de sada Misturador* 22 Copo misturador 23 Tampa 24 Funil * Se um acessrio no estiver includo no fornecimento, ele pode ser adquirido no comrcio da especialidade ou nos Servios Tcnicos.

Posies de trabalho Fig. B: Ateno! Utilizar o aparelho apenas se os acessrios forem aplicados, de acordo com esta tabela, no acionamento correto e na posio correta e se estiverem em posio de funcionamento. O brao mvel tem que estar engatado numa posio de trabalho.

132

pt Utilizao

Nota O brao mvel est equipado com a funo de Easy Armlift, que apoia o movimento ascendente do brao.

Ajuste da posio de trabalho: Acionar a tecla de desbloqueamento

e deslocar o brao mvel. Apoiar o movimento com uma das mos.

Movimentar o brao mvel at este encaixar na posio de trabalho pretendida.

Posio Acionamento Ferra- menta/ Acessrio

Veloci- dade de funciona- mento

1 7

17

15

13

2 7 *

3 6 37

35

4

9 57

7 57

* Montar / desmontar as varas para massas leves, para bater claras em castelo e massas pesadas.

Utilizao W Perigo de ferimentos!

S ligar a ficha tomada quando estiverem concludos todos os preparativos para o trabalho com o aparelho. Ateno! Utilizar o aparelho somente com acessrios/ferramentas na posio de funcionamento. No colocar o aparelho vazio em funcionamento. No expor o aparelho nem os acessrios a qualquer fonte de calor. As peas no so prprias para utilizar no microondas.

Limpar bem o aparelho e os acessrios, antes da primeira utilizao, ver Limpeza e manuteno.

Preparao Colocar o aparelho base sobre uma

superfcie lisa e limpa. Puxar o cabo para fora, at ao

comprimento pretendido (mx. 100 cm) e, depois, libertlo lentamente; o cabo fica bloqueado (Fig. C).

Reduzir o comprimento de servio do cabo: puxar suavemente o cabo e deixlo enrolar at ao comprimento desejado. Depois, puxar novamente o cabo e libertlo lentamente; o cabo fica bloqueado.

Ateno! Se o cabo prender, puxlo totalmente para fora e, depois, deixlo enrolar at ao fim.

Ligar a ficha tomada.

Tigela e ferramentas Observe os exemplos de aplicao na tabela. L

W Perigo de ferimentos devido a ferramentas em rotao! Durante o funcionamento, nunca tente agarrar a tigela. Trabalhar sempre com a tampa colocada (12)!

133

ptUtilizao

Trocar as ferramentas s com o acionamento completamente imobilizado depois de desligado, o acionamento ainda se movimenta por breves instantes e fica imobilizado na posio de substituio de ferramentas. Movimentar o brao mvel s depois de a ferramenta ficar completamente imobilizada. Cobrir os acionamentos no utilizados sempre com as respetivas tampas de proteo. Ateno! Utilizar a tigela apenas para trabalhar com este aparelho. Vara para massas leves Profi Flexi (13) para bater massas, p. ex. massa para bolos, bolo de frutas, etc., e para envolver ingredientes, como passas e pedaos de chocolate Vara para claras em castelo Profi (14) para bater claras de ovo e natas (no mnimo 30 % de teor de gordura) e para misturar massa para biscoitos Vara para massas pesadas (15) para amassar massas, p. ex. massa lveda, massa de po, massa para pizza, massa aliment cia, massa para bolos e para envolver ingredientes, como sementes, na massa Indicaes importantes sobre a utilizao da vara para bater claras em castelo (Fig. D): A vara quase deve tocar o fundo da taa, para otimizar a mistura dos ingredientes. Se tal no acontecer, adaptar da seguinte forma o ajuste em altura da vara para bater claras em castelo:

Retire a ficha da tomada. Premir a tecla de

desbloqueamento e colocar o brao mvel na posio 2.

Introduzir a vara para bater claras em castelo no acionamento at ao encaixe.

Segurar bem a vara para claras em castelo e soltar a porca com uma chave de bocas (tamanho 8) no sentido dos ponteiros do relgio.

Ajustar a altura da vara rodandoa at atingir a altura ideal: Rodar no sentido dos ponteiros do relgio: levantar. Rodar no sentido contrrio ao dos ponteiros do relgio: baixar.

Premir a tecla de desbloqueamento e colocar o brao mvel na posio 1.

Controlar a altura da vara e, se necessrio, corrigir.

Se a altura estiver corretamente ajustada, premir a tecla de desbloqueamento e deslocar o brao mvel para a posio 2.

Segurar bem a vara para claras em castelo e apertar a porca com uma chave de bocas (tamanho 8) no sentido contrrio ao dos ponteiros do relgio.

Trabalhar com a tigela e as ferramentas (Fig. E):

Premir a tecla de desbloqueamento e colocar o brao mvel na posio 2.

Colocar a tigela: Colocar a tigela inclinada para a frente e pousar; rodar no sentido contrrio ao dos ponteiros do relgio at engatar.

Em funo do trabalho a realizar, introduzir a vara para massas leves, a vara para bater claras em castelo ou a vara para massas pesadas at ela ficar bem fixa no acionamento.

Nota: No caso de massas pesadas, rodar a proteo das massas at que a vara possa encaixar (Fig. E-4b).

Colocar os ingredientes a serem trabalhados dentro da tigela.

Premir a tecla de desbloqueamento e colocar o brao mvel na posio 1.

Colocar a tampa. Regular o seletor para a fase

pretendida.

134

pt Utilizao

Adicionar ingredientes Desligar o aparelho atravs do seletor. Introduzir os ingredientes atravs da

abertura na tampa. ou

Retirar a tampa. Premir a tecla de

desbloqueamento e colocar o brao mvel na posio 2.

Introduzir os ingredientes. Depois do trabalho

Desligar o aparelho atravs do seletor. Retire a ficha da tomada. Retirar a tampa. Premir a tecla de

desbloqueamento e colocar o brao mvel na posio 2.

Retirar a ferramenta do acionamento.

Desmontar a tigela. Limpar todos os componentes, ver

Limpeza e manuteno.

Dispositivo para cortar e ralar Observe os exemplos de aplicao na tabela. M

W Perigo de ferimentos! No tocar nas lminas afiadas nem nas arestas dos discos de picar. Segurar os discos de triturar apenas pelos bordos! Montar/desmontar o dispositivo para cortar e ralar somente com o acionamento completamente imobilizado e com a ficha desligada da tomada. No tocar no compartimento de enchimento. Ateno! O dispositivo para cortar e ralar s deve ser utilizado na situao de completamente montado. Nunca montar o dispositivo para cortar e ralar no aparelho base. O dispositivo para cortar e ralar s deve funcionar na posio de funcionamento apresentada.

Proteo contra sobrecarga Fig. F: Para se evitarem danos importantes no seu aparelho em caso de sobrecarga no dispositivo de cortar e ralar, o veio de acionamento deste dispositivo dispe de um entalhe (ponto terico de rutura). Em caso de sobrecarga, o veio de acionamento quebra neste ponto. Um novo suporte de discos com veio de acionamento pode ser adquirido nos nossos Servios Tcnicos. Disco reversvel Profi Super- cut grosso/fino para cortas alimentos em rodelas grossas ou finas, p. ex. fruta e legumes. Marcao:

Grosso = rodelas grossas Fino = rodelas finas

Nota: no adequado para processar queijo rijo, po, pezinhos ou chocolate. Dica: Corte batatas cozidas apenas depois de arrefecerem. Disco reversvel de ralar grosso/fino para ralar alimentos em pedaos grossos ou finos, p. ex. fruta, legumes ou queijo, como Gouda ou Edamer. Marcao:

2 = lado grosso 4 = lado fino

Nota: no adequado para processar nozes ou queijo duro, p. ex. parmeso. Dica: Rale queijos moles com o lado mais grosso. Disco de raspar fino para raspar alimentos finamente, p. ex. nozes ou queijo duro, tal como parmeso. Nota: no adequado para processar queijo mole e fatiado. Disco reversvel de cortar/ralar para ralar batatas cruas ou cortar em rodelas. Nota: no adequado para processar alimentos fibrosos, p. ex. alho francs ou manga.

135

ptUtilizao

Trabalhar com o dispositivo para cortar e ralar Fig. G:

Premir a tecla de desbloqueamento e colocar o brao mvel na posio 2.

Colocar a tigela: Colocar a tigela inclinada para a frente e pousar; rodar no sentido contrrio ao dos ponteiros do relgio at engatar.

Premir a tecla de desbloqueamento e colocar o brao mvel na posio 3.

Retirar a tampa de proteo do acionamento do dispositivo de corte (Fig. G-5a).

Segurar o suporte de discos pela extremidade inferior; nesta situao, as duas pontas tm que apontar para cima.

Assentar com cuidado os discos de cortar e de ralar pretendidos nas pontas do suporte de discos (Fig. G-6a). No caso dos discos reversveis, ter ateno para que o lado pretendido fique virado para cima.

Segurar o suporte de discos pela extre midade superior e inserilo na caixa (Fig. G-6b).

Assentar a tampa (ateno marcao) e rodar no sentido dos ponteiros do relgio at prender.

Colocar o dispositivo para cortar e ralar no acionamento, conforme ilustrado na Fig. G-8, e rodar no sentido dos ponteiros do relgio at prender.

Posicionar o seletor na fase recomendada.

Adicionar os alimentos para preparar atravs do compartimento de enchi mento e empurrar com o calcador.

Ateno! Evitar a acumulao de alimentos cortados na sada. Dica: Para obter cortes uniformes, preparar o produto para cortar em molhos de pequeno volume.

Indicao: Se os alimentos a preparar ficarem agarrados ao dispositivo de corte, dever desligar a mquina, retirar a ficha da tomada e aguardar at o acionamento estar completamente parado, retirar a tampa do dispositivo de corte e esvaziar o compartimento de enchimento. Depois do trabalho

Desligar o aparelho atravs do seletor. Rodar o dispositivo para cortar e ralar

em sentido contrrio ao dos ponteiros do relgio e retirlo.

Rodar a tampa em sentido contrrio ao dos ponteiros do relgio e desmontla.

Retirar o suporte de discos com o disco. Para isso, e com o dedo por baixo, pressionar contra o veio de aciona mento (Fig. H).

Limpar os vrios componentes.

Misturador Observe os exemplos de aplicao na tabela. N

W Perigo de ferimentos devido lmina afiada/aos acionamentos em rotao! Nunca segurar no misturador, depois de este estar montado! Desmontar/montar o misturador s com o acionamento completamente parado! O misturador s deve funcionar na situao de completamente montado e com a tampa colocada. No utilize o misturador vazio.

W Perigo de queimaduras! Ao trabalhar com produtos quentes, verificase uma passagem de vapor atravs do funil para a tampa. Trabalhar com o misturador Fig. J:

Premir a tecla de destrava mento e colocar o brao mvel na posio 4.

Retirar a tampa de proteo do acionamento do misturador.

Colocar o copo misturador (marcao na asa com marcao do aparelho base) e rodar no sentido contrrio ao dos ponteiros do relgio at prender.

136

pt Limpeza e manuteno

Introduzir os ingredientes. Quantidade mxima de lquido = 1,25 litros; quantidade mxima de lquidos quentes ou que formem espuma = 0,75 litros.

Assentar a tampa e rodar em sentido contrrio ao dos ponteiros do relgio at ao batente no punho do misturador. A tampa tem que estar bem encaixada.

Regular o seletor para a fase pretendida. Adicionar ingredientes Fig. J-8:

Desligar o aparelho atravs do seletor. Desmontar a tampa e adicionar os

ingredientes ou

desmontar o funil e introduzir lentamente os ingredientes slidos na abertura de enchimento

ou introduzir os ingredientes lquidos

atravs do funil. Depois do trabalho

Desligar o aparelho atravs do seletor. Rodar o copo misturador no sentido dos

ponteiros do relgio e desmontlo. Dica: Limpar o copo misturador imediatamente aps utilizao.

W Ateno! Alimentos inapropriados podem danificar o aparelho.

No processe alimentos quentes acima dos 70 C no copo misturador.

No processe alimentos congelados, exceto cubos de gelo, se tiver adi cionado uma quantidade de lquido suficiente.

No processe alimentos que contenham componentes rijos. Antes da preparao de frutos com caroo ou pevides (mas, pssegos, etc.) retire os caroos ou as pevides.

Notas Limitaes ao processamento:

No triture ingredientes como amn doas, cebolas, salsa e carne.

O liquidificador no consegue produzir cremes para barrar como manteiga de amendoim, manteiga de coco ou pur de frutos de casca rija.

Misturar alimentos slidos com uma quantidade suficiente de lquido.

Misturar alimentos em p com uma quantidade suficiente de liquido ou dissolvlos completamente em lquido antes de os liquidificar. Alimentos em p so, p. ex., acar de confeiteiro, cacau em p, gros de soja torrados, farinha, protenas em p.

Limpeza e manuteno As peas de acessrios utilizadas tm de ser bem limpas aps cada utilizao. X Tabela O Ateno! No utilizar produtos de limpeza abrasivos. As superfcies exteriores podem sofrer danos.

Limpar o aparelho base W Perigo de choque eltrico!

Nunca mergulhar o aparelho base em gua nem lavlo sob gua corrente. No utilizar aparelhos de limpeza a vapor.

Retire a ficha da tomada. O aparelho base e a tampa de proteo

do acionamento devem ser limpos com um pano hmido. Se necessrio, utilizar um pouco de detergente da loia.

De seguida, secar bem o aparelho com um pano.

Limpeza da tigela e das ferramentas A tigela e as ferramentas podem ser lavadas na mquina de lavar loia. No entalar as peas de plstico dentro da mquina, pois podem verificarse ligeiras deformaes durante a lavagem.

137

ptArrumao

Limpar o dispositivo para cortar e ralar

W Perigo de ferimentos devido lmina afiada!

No tocar nas lminas afiadas nem nas arestas do disco de picar. Para a sua limpeza, utilizar uma escova. Todos os componentes do dispositivo para cortar e ralar podem ser lavados na mquina de loia. Dica: Para eliminar a camada vermelha depois da preparao de, p. ex., cenouras, molhar um pano com um pouco de leo alimentar e passar com ele no dispositivo para cortar e ralar (no nos discos de triturar). Depois, lavar o dispositivo de cortar e ralar.

Limpeza do misturador W Perigo de ferimentos devido

lmina afiada! No tocar com as mos na lmina do misturador. O copo misturador, a tampa e o funil podem ser lavados na mquina de lavar loia. Dica: Depois da preparao de lquidos, frequentemente suficiente limpar o mistura dor sem o retirar do aparelho base. Para isso, adicione 700 ml de gua com uma gota de detergente de loia no mistu rador montado na mquina. Ligue o mis turador durante aprox. 1 minuto (nvel 7). Despeje a gua de lavagem e, depois, fazer nova passagem com gua limpa. Indicao importante: Se necessrio, limpar a bolsa de acessrios. Dar ateno s indicaes de limpeza existentes na bolsa de acessrios.

Arrumao W Perigo de ferimentos!

Se o aparelho no estiver em utilizao, dever retirar a ficha da tomada. Fig. K:

Arrumar as ferramentas e os discos de picar na bolsa de acessrios.

Arrumar a bolsa de acessrios dentro da tigela.

Ajuda em caso de anomalia W Perigo de ferimentos!

Antes de tentar eliminar qualquer anomalia, desligue a ficha da tomada. Indicao importante: A indicao de funcionamento a piscar indica um erro no manuseamento do apare lho, uma ativao do dispositivo eletrnico de segurana ou uma avaria no aparelho. O brao mvel tem que estar engatado numa posio de trabalho. Primeiramente, dever tentar eliminar o problema surgido, com a ajuda das indicaes seguintes. Avaria O aparelho no arranca. Soluo

Verificar se h corrente. Verificar a ficha. Verificar o brao mvel.

Posio correta? Bem engatado? Apertar bem, rodando at ao batente, o

copo misturador ou a tigela. Colocar a tampa do copo misturador e

apertla bem, rodandoa at prender. Colocar a tampa de proteo dos

acionamentos que no esto em utilizao.

A proteo contra ligao indevida est ativa. Colocar o aparelho em 0/off e depois retornar para a fase desejada.

Avaria O aparelho desliga durante o funcionamento. A proteo contra sobrecarga foi ativada. Foram preparados demasiados alimentos em simultneo. Soluo

Desligar o aparelho. Reduzir as quantidades a preparar.

Avaria Com o acionamento a funcionar, a tecla de desbloqueamento foi ativada inadvertidamente. O brao mvel deslocase para cima. O acionamento desliga, mas, no entanto, no fica parado na posio de substituio da ferramenta.

138

pt Exemplos de utilizao

Soluo Posicionar o seletor em 0/off. Deslocar o brao mvel para a

posio 1. Ligar o aparelho (fase 1). Desligar de novo o aparelho.

A ferramenta fica parada na posio de substituio. Avaria O copo misturador no arranca ou para durante o uso, o acionamento provoca zumbidos. A lmina est bloqueada. Soluo

Desligar o aparelho e retirar a ficha da tomada.

Desmontar o copo misturador e eliminar o obstculo.

Voltar a montar o copo misturador. Ligue o aparelho.

Indicao importante Se no for possvel eliminar a anomalia, deve dirigirse aos Servios Tcnicos.

Exemplos de utilizao Observe as recomendaes gerais nas tabelas L, M e N. No ultrapasse as quantidades mximas permitidas.

Massa tipo biscoito Receita base 2 ovos 23 colheres de sopa de

gua quente 100 g de acar 1 pacotinho de acar baunilhado 70 g de farinha 70 g de fcula um pouco de fermento em p Bater os ingredientes (excepto a farinha

e a fcula) ca. de 46 minutos na fase 7 com as varas para massas leves, at formar espuma.

Rodar o selector para a fase 1 e misturar, colher a colher, a farinha peneirada e a fcula durante ca. de at 1 minuto.

Quantidade mxima: 2 x a receita base

Massas leves Receita base 6 ovos 500 g de acar 1 pitada de sal 2 pacotinhos de acar baunilhado

ou a casca de limo 500 g de manteiga ou margarina

( temperatura ambiente) 1000 g de farinha 1 pacote de fermento em p 250 ml de leite Com a vara para massas leves, misturar

os ovos, o acar, o sal e o acar baunilhado ou a casca de limo durante ca. de 10 segundos na fase 1.

Seleccionar a fase 5 e processar durante ca. de 120 segundos.

Adicionar a manteiga e misturar durante ca. de 60 segundos na fase 3.

Adicionar a farinha e o fermento e processar durante ca. de 2 minutos na fase 1.

Seleccionar a fase 3 e, em 2 minutos, adicionar o leite aos poucos.

Quantidade mxima: 1 x a receita base

Bolo de fruta pesado Receita base 3 ovos 135 g de acar 135 g de margarina 255 g de farinha 10 g de fermento em p 150 g de corintos 150 g de mistura de frutos secos Coloque a vara para massas leves. Deite todos os ingredientes exceto os

frutos secos. Processe durante 30 segundos no

nvel 1. Depois, processe durante 35 minutos

no nvel 5. Regule para o nvel 2. Adicione os frutos secos dentro de

3060 segundos. Quantidade mxima: 2 x a receita base

139

ptAcessrios especiais

Massa quebrada Receita base 125 g de manteiga

( temperatura ambiente)

100125 g de acar 1 ovo 1 pitada de sal Um pouco de casca de limo

ou acar baunilhado 250 g de farinha um pouco de fermento em p Misturar todos os ingredientes durante

aprox. minuto no nvel 1, depois, aprox. 36 minutos no nvel 3 com a vara para massas leves.

A partir de 250 g de farinha: Com a vara para massas pesadas,

amassar durante ca. de minuto na fase 1 e, depois, 56 minutos na fase 3.

Quantidade mxima: 2 x a receita base

Massa levedada Receita base 500 g de farinha 1 ovo 80 g de gordura ( temperatura

ambiente) 80 g de acar 200250 ml de leite morno 25 g de fermento fresco

ou um pacotinho de fermento seco Raspa de casca de limo 1 pitada de sal Trabalhar todos os ingredientes durante

cerca de minuto na fase 1 e, depois, cerca 36 minutos na fase 3 com as varas para massas pesadas.

Quantidade mxima: 2 x a receita base

Massa batida Receita base 300 g de farinha 3 ovos se necessrio, juntar 12 colheres de

sopa (1020 g) de gua fria Trabalhar todos os ingredientes ca. de

3 a 5 minutos na fase 3 at formar uma massa

Quantidade mxima: 1,5 x a receita base

Massa para po Receita base 1000 g de farinha 2 pacotinho de fermento em p 2 colheres de ch de sal 600650 ml de gua quente Trabalhar todos os ingredientes durante

cerca de minuto na fase 1 e, depois, cerca 67 minutos na fase 3 com as varas para massas pesadas.

Maionese 1 ovo 1 colher de ch de mostarda l de leo 1 colher de sopa de sumo de limo ou

vinagre 1 pitada de sal 1 pitada de acar

Os ingredientes tm de estar temperatura ambiente. A preparao de maionese s possvel com ovos inteiros.

Misturar os ingredientes (excepto o leo) no misturador, na fase 3 ou 4, durante alguns segundos.

Comutar o misturador para a fase 7 e deitar lentamente o leo atravs do funil, continuando a mexer at que a maionese tenha a consistncia pretendida.

Consumir a maionese rapidamente, no a guardar.

Acessrios especiais Poder adquirir acessrios especiais junto da Assistncia Tcnica, no comrcio especializado ou atravs da Internet. Utilize apenas acessrios originais, uma vez que foram especificamente concebidos para utilizao com o aparelho. Os acessrios so especficos do aparelho. Quando comprar acessrios especiais, indique sempre a designao exata (ENr.) do seu aparelho. Verifique quais os acessrios disponveis para o seu aparelho no nosso catlogo, na loja online ou junto do Servio de Assistn cia Tcnica. www.bosch-home.com

140

pt Eliminao do aparelho

Eliminao do aparelho

J Eliminar a embalagem de forma ecolgica. Este aparelho est marcado em conformidade com a Directiva 2012/19/UE relativa aos resduos de equipamentos elctricos e electrnicos (waste electrical and electronic equipment WEEE). A directiva estabelece o quadro para a criao de um sistema de recolha e valorizao dos equipamentos usados vlido em todos os Estados Membros da Unio Europeia. Contactar o revendedor especializado para mais informaes.

Garantia Para este aparelho vigoram as condies de garantia publicadas pelo nosso repre- sentante no pas em que o mesmo for adquirido. O representante onde comprou o aparelho poder dar-lhe mais pormenores sobre este assunto. Para a prestao de qualquer servio dentro da garantia , no entanto, necessria a apresentao do documento de compra do aparelho.

Salvo alteraes tcnicas.

141

el

. ,. , . . . ,. . , 2.000m .

, ! . . , /, . . . .

W ! ., . ,.. , .

.

. !

142

el

,... .

. ..

,, , . W !

, , . . .

, .

, ! , !

. (..) .,, .

2. .

. . .

. .

. ! .

143

el

, . W !

,. W !

. W !

, . ().

W ! (X       150).

W

i .

Y !.

W !. .

O Bosch. .

.............................................. 141 ............ 141 .............................. 144 ............................................. 144 ....................................... 145 .................................................. 145 ........................ 150 ..................................................... 151 .............................. 151 ...................... 152 .................................... 153 ................................................ 153

144

el

. 13: (11)

.

, . 0/off,.

, . . - - . .

A: 1 2

EasyArmlift ().

3 ( 0/off) . 0/off=

M= , . 1-7,: 1=, 7=.

4 (M 17). , , .

5 .

6 (). , .

7 (,,) (*)

8

9 ( *) , .

10 11 12 13 Profi Flexi 14 15 16

.

145

el

17 18 19

a Profi Supercut-/

b - /

c d -,

* 20 21 * 22 23 24 * , .

B: ! , / . . : EasyArmlift, .

:

. .

, .

/ -

-

1 7

17

15

13

2 7 *

3 6 37

35

4

9 57

7 57

* /, .

W !

. . ! /. . . .

146

el

, .

.

(100cm) , ( C).

: . ,.

! , .

.

.L

W ! . (12)! . , . . ! .

Profi Flexi (13) ,.. ,.. (14) (30% ) (15) ,.. ,, ,, ( D) , ., :

. 2.

.

(SW8) .

, : :. :

1.

, ,.

, 2.

147

el

(SW8) .

( E):

2.

: , .

, , .

: , ( E4b).

,.

1.

. .

.

.

. 2.

.

.

.

. 2.

.

. , .

.M

W ! . ! / . . ! . . . F: , ( ). . .

148

el

Profi Supercut - / ,... :

= =

: ,, . : . - / ,..,, . :

2= 4=

: ,.. . : . ,.. ,. : . -, . : ,... G:

2.

: , .

3.

( G-5a).

, .

( G-6a). .

( G-6b).

() .

, G-8 .

.

.

! . : . : , ,

149

el

, , .

.

.

.

. ( H).

.

.N

W / ! !/ , ! , . .

W ! , . J:

4.

.

( ) .

. ,=1,25, =0,75.

. .

.

J-8:

.

-

.

.

.

: .

W ! , .

70C.

,, .

. (, ..), .

150

el

:

, ,.

, .

.

. ..,, ,, .

. XO ! . .

W ! . .

. ., .

.

. , !

W !

. . . : .., ( ). .

W

! . , . : , . 700ml . 1 (7). . : , . .

151

el

W !

, . K:

.

.

W !

. : , . . . .

. . . ;;

. .

.

. 0/off .

. . .

. .

. . , .

0/off.

1.

(1).

. . ,. .

.

.

. .

, .

152

el

L, MN. .

2 2-3(..)

100g 1. 70g 70g ( ), , 4-67 .

1 , 1 .

:2

6 500. 1 2

500. ()

1000. 1 250ml ,, 10 1.

5 120.

603.

21.

3 -2.

:1

3 135. 135. 255. 10. 150. 150. . , .

30 1.

,3-5 5.

2. 30-60 .

:2

125g( )

100-125g 1 1 250g 1 3 3-6.

250. 1 ,. 563.

153

el

:2

500g 1 80g() 80g 200-250ml 25g1.

1 1. 3-63 .

:2

300g 3 1-2.(10-20g)

353.

:1,5

1000g 2 2.. 600650ml 1. 673 .

1 1 1 1 1

. .

() 34.

7, .

, .

, . , . . (E-Nr.). , ,Online-Shop . www.bosch-home.com

J . 2012 / 19 / E (waste electrical and electronic equipment WEEE). . , .

.

1. (24) . . 2. ,,- - (,,.).- ,, ,BSH... . 3. ,()BSH ..., . 4. ()BSH ... BSH... . 5. ( )BSH... 6. - (..). 7. , . 8. : ,

BSH... ,,

/, ,.

. ,,,,,

, .

9. ()BSH ... 10.. 11..

BSH ... 17-&20,14564,

..............................17&20,14564 / ...........................,,570,..60017 ..............................57.26224 .........23&,71306 .............................39.2407,

18182 ...............................24/7,

01/17

155

tr Amacauygunkullanm

Amaca uygun kullanm Bucihazsadeceevdeveevortamndakullanlmakiintasarlanmtr. Cihazsadeceevinizdehazrlayacanzmiktarlarvesreleriin kullannz.Cihaz,besinlerinkartrlmas,yorulmasverplmas iinuygundur.Cihazbakacisimlerinveyamaddelerinilenmesiiin kullanlmamaldr.reticitarafndanizinverilmibakaaksesuarlar kullanarakeitliuygulamalarngerekletirilmesidemmkndr. Cihazsadeceizinverilenorijinalparalarveaksesuarlarilebirlikte kullannz.Bakacihazlaraaitaksesuarlarkesinliklekullanmaynz. Cihazsadecenormalodascaklndavedenizseviyesindenen fazla2000myksekliktekullannz.

nemli gvenlik uyarlar Kullanmklavuzunudikkatliceokuyunuz,verilenbilgileregre hareketedinizveileridebavurmakzerezenlesaklaynz!Cihaz bakabirineverirkencihazilebirliktebuklavuzudateslimediniz. Cihazndorukullanmnayneliktalimatlarndikkatealnmamas nedeniyleoluabilecekhasarlardanreticisorumlututulamaz. Bucihazfiziksel,duyusalyadazihinselengeliolanyadadeneyimi vebilgisiyetersizolankiilertarafndansadece,sorumlubir kiininnezaretialtndaveyacihazngvenlikullanmkonusunda bilgilendirilmiolmalarvekullanmdankaynaklanantehlikeleri anlamolmalarhalindekullanlabilir.ocuklarcihazdanvebalant kablosundanuzaktutulmaldrvecihazkullanmalaryasaktr. ocuklarcihazlaoynamamaldr.Temizlikvekullancbakm almalarocuklartarafndangerekletirilmemelidir.

W Elektrik arpma tehlikesi ve yangn tehlikesi! Cihazkesinlikletipetiketizerindekibilgilereuygunekilde balaynzvealtrnz.Cihaznkendisindeveyaelektrik kablosundahasarvarsacihazkesinliklekullanmaynz.Hertrl tehlikeninnlenmesiamacyla,rn.hasarlbirelektrikbalant kablosunundeitirilmesigibicihazzerindegerekletirilecektm onarmlarsadeceyetkiliservisimiztarafndanyrtlmelidir.

Cihazsadecedneralterileanzvekapatnz. Cihazkesinliklezamanayarlalterlereveyauzaktankumandal prizlerebalamaynz.Cihaziletimsrasndasrekliolarak gzetimaltndatutunuz!

Cihaz,ocakgibiscakyzeylerinzerineveyayaknna koymaynz.Elektrikebekesikablosunuscakparalariletemas ettirmeyinizveyasivrikenarlarzerineekmeyiniz.

Cihazkesinliklesuyadaldrlmaynzveyabulakmakinesinde ykamaynz.Buharltemizlemealetikullanmaynz.Cihaz,elleriniz nemliveyaslakdurumdaykenkullanmaynz.

156

tr nemligvenlikuyarlar

Cihazherkullanmdansonra,gzetimaltndadeilken,paralarn ayrmadan,birletirmedenvetemizlemedennceveacil durumlardamutlakaelektrikebekesindenayrnz. W Yaralanma tehlikesi!

Cihaznkullanmsrasndahareketedenaksesuarparalarn veyayedekparalardeitirmedennce,cihazkapatnzve elektrikebekesindenayrnz.Cihazkapatldktansonra,tahrik sistemi(motor)ksabirsrehareketetmeyedevameder.Tahrik sisteminin(motorun)tamamendurmasnbekleyiniz.

Cihazalmakonumundayken,evirmekolununayarndabir deiiklikyapmaynz.

Aletlerisadecekapyerletirilmi,tpataklmvetahrikkoruyucu kapakkapatlmdurumdaykenkullannz!Aksesuarkullanm iinkab,kapavetahrikkoruyucukapatalimatlaragre yerletiriniz!

almasrasndaellerinizikesinliklekabnveyadolumaznn iinesokmaynz.Kabnveyadolumaznniineherhangibir cisim(rn.piirmeka)sokmaynz.Ellerinizi,salarnz, kyafetlerinizivedierkiiseleyalarnzdnerparalardan uzak tutunuz.

Aletleriveaksesuarlarveya2aksesuarbirdenkesinlikleayn andakullanmaynz.Aksesuarlarkullanrken,butalimatlarile birlikteilgiliaksesuarlaraaitkullanmklavuzlarndadikkatealnz.

Aksesuarlarsadecekomplemonteedilmidurumdayken kullannz.Aksesuarlarkesinlikleanacihazzerindemonte etmeyiniz.Aksesuarlarsadecekendileriiinngrlenalma konumundakullannz.

Elinizlekeskinbaklaravedoramadiskininkenarlarna dokunmaynzvetutmaynz.Doramadisklerinisadecekenardan tutunuz!

Mikserinbaklarnaplakelleriniziledokunmaynz. Miksercihazataklykenkesinliklemiksereelinizisokmaynz! Mikserikesinliklekapayokkenaltrmaynz.

Keskinbaklarilealrken,kabboaltrkenvetemizlikyaparken dikkatliolun. W Halanma tehlikesi var!

Mikserdescakmalzemeilendiizaman,kapakdakihunidenscak buharkar.

W Boulma tehlikesi! ocuklarnambalajmalzemeleriileoynamasnaizinvermeyiniz.

157

tr nemligvenlikuyarlar

Yeni bir Bosch cihaz satn aldnz iin sizi candan kutluyoruz. rnlerimiz hakkndaki ayrntl bilgileri internet sayfamzda bulabilirsiniz.

erik Amacauygunkullanm............................. 155 nemligvenlikuyarlar ......................... 155 Gvenlik sistemleri ................................... 157 GenelBak .............................................. 158 almakonumlar ................................... 158 Kullanm ................................................... 159 Temizlikvebakm ..................................... 163 Muhafaza ................................................. 164 Arzadurumundayardm ......................... 164 Kullanmrnekleri ................................... 165 zel aksesuar .......................................... 166 Eldenkartlmas..................................... 167 Garanti ...................................................... 167

W Dikkat! Cihazn,besinlerinhazrlanmasiingerekliolandanuzunsreyle aktutulmaskesinlikletavsiyeedilmez.Cihazboaltrmaynz.

W nemli! Cihazherkullanmdansonraveyauzunsrekullanlmadysamutlaka iyicetemizlenmelidir(X Temizlik ve bakm bkz. sayfa 163).

W Cihazdaki ya da aksesuarlardaki sembollerin aklamas

i Kullanmaklavuzununtalimatlarnauyunuz.

Y Dikkat!Dnenbaklar.

W Dikkat!Dnenaletler. Elinizimalzemeilaveetmeaziinesokmaynz.

Gvenlik sistemleri Devreye sokma emniyeti Bkz.almakonumlartablosu. Cihaz1 ve 3numaralkonumdaykensadece aadakikoullaraltndaaltrlabilir:

Kap(11)yerletirilmiseveyerineoturun cayakadardndrlmse.

Tekrar devreye girme emniyeti Elektrikkesintisihalindecihazakdurumda kalmayadevamederancakkesintisona erdiindemotortekraralmayabalamaz. Cihaztekrardevreyesokmakiindner alteri0/offkonumunaevirinizveardndan cihazdevreyesokunuz.

Ar yklenme emniyeti Cihazkullanlrkenmotorkendiliinden durursa,aryklenmeyekarkoruma zelliidevreyesokulmudemektir.Bunun nedeni,aynandaokmiktardabesinin ilenmeyeallmasolabilir.

Bir emniyet sisteminin devreye girmesi halinde yaplmas gerekenleri renmek iin Arza durumunda yardm blmn inceleyiniz. Cihaznbakmaihtiyacyoktur.

158

tr GenelBak

Genel Bak Resim A: Ana cihaz 1 Kilit ama tuu 2 evirme kolu

Kolunyukardoruhareketini desteklemekiinEasyArmlift(kolay kolkaldrma)fonksiyonu(bkz.alma konumlar).

3 Dner alter Kapatmaileminden(0/off konumu) sonracihazotomatikolarakalet deitirmekiinenidealpozisyona hareket eder. 0/off = Durdurma M=Azamidevirlimomentdevresi, istenenkartrmasresiboyuncaalter basltutulmaldr. Kademe 1-7,almahz: 1=dkdeviryava, 7=yksekdevirhzl.

4 letim gstergesi Cihaznkullanmsrasndayanar(dner alterkonumuM veya 1-7).Cihazn kullanmsrasndahataolumas, elektroniksigortann/emniyetindevreye girmesiveyacihaznarzalanmas halindeyanpsner,bkz.Arza durumundayardm.

5 Tahrik sistem koruyucu kapa Tahriksistemikoruyucukapan kartmakiinkapanarkaksmna bastrlmalvekapakkartlmaldr.

6 Tahrik sistemi Dorayc ve Narenciye skaca (zel aksesuar*) iin. Cihazkullanlmadndatahriksistemi koruyucukapataklolmaldr.

7 Tahrik sistemi Aletler (kartrmateli,rpmateli, yourmakancas)veet kyma nitesi (zelaksesuar*)iin

8 Mikser tahrik sistemi koruyucu kapa 9 Mikser tahrik sistemi (zel aksesuar*)

Cihazkullanlmadndatahriksistemi koruyucukapataklolmaldr.

10 Kablo sarma otomatii

Kap ve aksesuarlar 11 Paslanmaz elik kartrma kab 12 Kapak Aletler 13 Profi Flexi kartrma teli 14 Profi rpma teli 15 Yn deitirmeli yourma kancas 16 Aksesuar antas

Aletlerinvedoramadisklerinin muhafazaedilmesiiinkullanlr.

Dorayc 17 Tka 18 Doldurma azl kapak 19 Dorama diskleri

a ProfiSupercutevrilebilendisk kaba/ince

b evrilebilenrendelemediski kaba/ince

c Rendelemediskiince d Kesmekveraspalamakiin

evrilirdisk* 20 Disk mesnedi 21 k delikli gvde Mikser* 22 Kartrma kab 23 Kapak 24 Huni *Teslimatkapsamndayeralmayan aksesuarparalarnilgilisatclardan,yetkili servislerdenvemterihizmetlerindentemin edebilirsiniz.

alma konumlar Resim B: Dikkat! Cihazsadece,ilgilialet/aksesuarbu tabloyagredorutahriksisteminetaklm vedorukonumayerletirilmidurumdaysa vecihazalmakonumunagetirilmise altrnz.evirmekolu,heralma konumundayerineoturmuolmaldr. Uyar evirmekolu,kolunyukardoruhareketini destekleyenEasyArmlift(kolaykol kaldrma)fonksiyonuiledonatlmtr.

159

tr Kullanm

alma konumunun ayarlanmas: Kilitamatuunabasnzveevirme kolunuhareketettiriniz.Hareketibireliniz iledestekleyiniz.

evirmekolunuyerineoturuncayakadar istediinizpozisyonahareketettiriniz.

Pozisyon Tahrik sistemi

Alet/ aksesuar

alma hz

1 7

17

15

13

2 7 *

3 6 37

35

4

9 57

7 57

*rpma,kartrmaveyourmaularnn taklmas/karlmas.

Kullanm W Yaralanma tehlikesi!

Elektrikfiiniancak,cihazilealmakiin gerekliolantmhazrlklarntamamlanm olmashalindetaknz.

Dikkat! Cihazsadeceaksesuar/alettakldurumda vecihazalmakonumundaysaaltrnz. Cihazboolarakaltrmaynz.Cihazve aksesuarparalarnskaynaklarnamaruz brakmaynz.Paralarmikrodalgafrnlar iinuygundeildir.

Cihazilkkezkullanmayabalamadan nce,cihazveaksesuarlarniyice temizleyiniz,bkz.Temizlikvebakm.

Hazrlama Anacihazdzgnvetemizbiryzeyin zerinekoyunuz.

Kabloyutekbirhareketleistediiniz uzunlua(maks.100cm)kadarekip uzatnzveyavayavaserbestbraknz; bylecekablobuuzunluktakilitlenipkalr (Resim C).

Kabloalmauzunluununksaltlmas: Kabloyuhafifeekerek,istediiniz uzunluaulancayakadarsarlmasn salaynz.Dahasonrakabloyutekrar hafifeekerekyavayavaserbest braknz;byleliklekablobuuzunlukta kilitlenipkalr.

Dikkat! Kabloskacakolursa,kabloyutamamen darekipanzvesonratekrar sarlmasnsalaynz.

Elektrikfiiniprizetaknz.

Kaplar ve aletler Tablodayeralankullanmrneklerini inceleyiniz.L

W Dnen aletler nedeniyle yaralanma tehlikesi! Cihazalrkenelinizikartrmakabnn iinekesinliklesokmaynz.Cihazsadece kapak(12)kapalykenaltrnz! Cihazataklanaletlerisadececihazn tahriksistemi(motor)dururkendeitiriniz; cihazkapatldktansonradatahriksistemi ksasrealmayadevamedervealet deitirmepozisyonundadurur. evirmekolunuancakaletdurduktansonra hareketettiriniz. Kullanlmayantahrikleriherzamantahrik koruyucukapaklarilekapatnz.

160

tr Kullanm

Dikkat! Kabsadecebucihazilegerekletirdiiniz almalariinkullannz. Profi Flexi kartrma teli (13) Hamurunkartrlmasiindir,rn. Kek hamuru, meyveli kek vb. hazrlamakvekuruzmvepara ikolata gibi malzemeleri hamura katarak kartrmakiindir Profi rpma teli (14) Kremavekremantiyapmak(ya oranenaz%30)vebiskvihamuru hazrlamakiindir Yourma kancas (15) Hamuryourmakiindir,rn. Mayalhamur,ekmekhamuru, pizza hamuru, makarna hamuru, pastahamuruhazrlamakveekirdekii gibi malzemelerin hamurun iine katarak kartrlmasiindir rpma telinin kullanlmas ile ilgili nemli bilgi (Resim D): Malzemelerineniyiekildekartrlmas iin,rpmatelininkartrmakabnndibine neredeysetemasetmesigerekir.Temas etmiyorsa,rpmatelininykseklikayarnu ekildeyapnz:

Elektrikfiiniprizdenekipkartnz. Kilitamatuunabasnzve evirmekolunu2 konumuna getiriniz.

rpmateliniyerineoturuncaya kadartahriksistemininiinesokunuz.

rpmatelinisabittutunuzveak azlbiranahtar(anahtargenilii8) ilesomunusaatdnynnedoru znz.

rpmatelininseviyesini,telievirereken uygunseviyeyeayarlaynz: Saatdnynndeevirme:Kaldrma. Saatdnynnntersineevirme: ndirme

Kilitamatuunabasnzve evirmekolunu1 konumuna getiriniz.

rpmatelininseviyesinikontrol edinizvegerekirsedzeltiniz.

Seviyedoruayarlanmsa,kilit sisteminiamatuunabasnz veevirmekolunu2 konumuna getiriniz.

rpmatelinisabittutunuzveak azlbiranahtar(anahtargenilii8) ilesomunusaatdnynnntersine doruznz.

Kartrma kab ve aletler ile birlikte al- trma (Resim E):

Kilitamatuunabasnzve evirmekolunu2 konumuna getiriniz.

Kabyerletirme: neeimlikartrmakabnyerletiriniz vesonrasabitleyerekyerineoturana kadarsaatdnynnntersinedoru eviriniz.

Yaplacakiegrekartrmatelini, rpmateliniveyayourmakancasn, yerineoturuncayakadartahriksisteminin iinesokunuz.

Uyar: Yourmakancasnda,yourmakancas yerineoturuncayakadaryndeitirmeli dzeneinieviriniz(Resim E-4b).

lenecekmalzemelerikabadoldurunuz. Kilitamatuunabasnzve evirmekolunu1 konumuna getiriniz.

Kapataknz. Dneralteriistediinizkademeye ayarlaynz.

Malzeme ilave edilmesi Cihazdneralterzerindenkapatnz. Malzemeleri,kapaktakimalzemeilave etmeazndandoldurunuz.

veya Kapakartnz. Kilitamatuunabasnzve evirmekolunu2 konumuna getiriniz.

Malzemeleriilaveediniz. alma sona erdikten sonra

Cihazdneralterzerindenkapatnz. Elektrikfiiniprizdenekipkartnz. Kapakartnz.

161

tr Kullanm

Kilitamatuunabasnzve evirmekolunu2 konumuna getiriniz.

Aletitahriksisteminden kartnz.

Kartrmakabnkartnz. Tmparalartemizleyiniz,bkz. Temizlemevebakm.

Dorayc Tablodayeralankullanmrneklerini inceleyiniz.M

W Yaralanma tehlikesi! Elinizlekeskinbaklaravedoramadiskinin kenarlarnadokunmaynzvetutmaynz. Doramadisklerinisadecekenarlarndan tutunuz! Doraycysadececihazntahriksistemi (motor)dururkenveelektrikfiikarlm durumdaykentaknz/kartnz. Elinizibesindoldurmaaznasokmaynz. Dikkat! Doraycysadecekomplemonteedilmi durumdaykenkullannz.Doraycy kesinlikleanacihazzerindemonte etmeyiniz.Doraycysadecebelirtilen altrmakonumundaaltrnz. Ar yklenmeye kar koruma Resim F: Doraycnnaryklenmesidurumunda cihaznznfazlazarargrmesininlemek iin,doraycnntahrikmilindebirentik (zarurikrlmayeri)ngrlmtr.Aryk lenmeszkonusuolduunda,tahrikmilibu entiinbulunduuyerdenkrlr.Yenibir diskmesnediveilgilitahrikmili,yetkiliservis zerindenteminedilebilir. Profi Supercut evrilebilen disk kaba/ince Besinlerikalnveyaincedilimlerhalinde kesmekiindir,rn.Meyvevesebze. Tanmlama:

Kaba=Kalndilimler nce=ncedilimler

Bilgi: Sertpeynir,ekmek,sandviekmei veyaikolatailemekiinuygundeildir. Yararl bilgi:Pimipatatesleriancaksou duktansonrakesin.

evrilebilen rendeleme diski kaba/ince Besinlerinkalnveyainceparalarhalinde rendelenmesiiindir,rn.Meyve,sebzeveya GoudayadaEdamergibipeynireitleri. Tanmlama:

2 = Kaba taraf 4=ncetaraf

Bilgi: Fndkveyasertpeynirilemekiin uygundeildir,rn.Parmesan. Yararl bilgi:Yumuakpeynirikabatarafile rendeleyin. Rendeleme diski ince Besinlerininceekilderendelen mesiiindir,rn.Fndkveyaparmesangibi sertpeynirler. Bilgi:Yumuakpeynirveyadilimpeynir ilemekiinuygundeildir. Kesmek ve raspalamak iin evrilir disk ipatateslerirendelemekveyadilimler halindekesmekiindir. Bilgi:Liflibesinleriilemekiinuygundeil dir,rn.Prasaveyamango. Dorayc ile alma Resim G:

Kilitamatuunabasnzve evirmekolunu2 konumuna getiriniz.

Kabyerletirme: neeimlikartrmakabnyerletiriniz vesonrasabitleyerekyerineoturana kadarsaatdnynnntersinedoru eviriniz.

Kilitamatuunabasnzve evirmekolunu3 konumuna getiriniz.

Dorayctahriindentahrik sistemikoruyucukapankartnz (Resim G-5a).

Diskmesnedinienaltksmndantutunuz; busradaikiudayukarbakmaldr.

stediinizkesmeverendelemediskini diskmesnedininularnadikkatlice oturtunuz (Resim G-6a). evrilebilendisklerde,istediiniztarafn yukardaolmasnadikkatediniz.

162

tr Kullanm

Diskmesnedinistutantutunuz vegvdeniniineyerletiriniz (Resim G-6b).

Kapataknz(iaretedikkatediniz) vesaatdnynnedorudayanak noktasnakadareviriniz.

DoraycyResim G-8zerinde gsterilenekildetahriksisteminin zerinetaknzvesaatdnynne dorudayanaknoktasnakadareviriniz.

Dneralteritavsiyeedilenkademeye ayarlaynz.

lenecekbesinleridoldurmaazndan doldurunuzvetkaileieriitiniz.

Dikkat! Kesilenbesininkdeliindeylmasn nleyiniz. Yararl bilgi:Muntazamkesmesonular eldeetmekiin,kesilecekbesinlerinceise birdemetoluturarakkesiniz. Yararl bilgi:lenecekbesinlerdoraycda skrsamutfakrobotunukapatnz, elektrikfiiniprizdenekipkartnz,tahrik sisteminindurmasnbekleyiniz,doraycnn kapanapkarnzvebesindoldurma aznboaltnz. alma sona erdikten sonra

Cihazdneralterzerindenkapatnz. Doraycysaatdnynnntersine doruevirinizvecihazdankartnz.

Kapasaatdnynnntersine doruevirinizvekartnz.

Diskmesnedinidiskilebirliktekartnz. Bununiinparmaklaalttantahrikmiline dorubastrnz(Resim H).

Paralartemizleyiniz.

Mikser Tablodayeralankullanmrneklerini inceleyiniz.N

W Keskin baklar / dnen tahrik (motor) nedeniyle yaralanma tehlikesi sz konusudur! Miksercihazataklykenkesinliklemiksere elinizisokmaynz!Mikserisadecetahrik sistemidurmahalindeykenkartnz/ taknz!Mikseridaimatamamenmonte edilmiekildevekapankapatarakalt rnz.Mikserikesinlikleboaltrmaynz.

W Halanma tehlikesi! Mikserdescakmalzemelerileallrken kapaktakihunidenscakbuharkolur. Mikser ile alma Resim J:

Kilitamadmesinebasnzve evirmekolunu4 konumuna getiriniz.

Miksertahriksistemikoruyucu kapanyerindenkarnz.

Kartrmakabnyerinetaknz(kulp zerindekiokiaretianacihazdaki iaretedenkgelmelidir)vesaatdn ynnntersinedorudayanaknokta snakadareviriniz.

Malzemeleriilaveediniz. Azamisvmiktar=1,25litre;Azami kprenveyascaksvmiktar=0,75 litre.

Kapataknzvesaatdnynnn tersinedorudayanaknoktasnakadar evirerekmikserkulbununiinetaknz. Kapakyerineoturmuolmaldr.

Dneralteriistediinizkademeye ayarlaynz.

Malzeme ilave edilmesi Resim J-8:

Cihazdneralterzerindenkapatnz. Kapakartnzvemalzemeleri

doldurunuz veya

huniyikarnzvekatmalzemeleri ilendikeilaveetmeazzerinden ilaveediniz

veya

163

tr Temizlikvebakm

svmalzemelerihunizerindenilave ediniz.

alma sona erdikten sonra Cihazdneralterzerindenkapatnz. Mikserisaatdnynndeevirinizve cihazdankartnz.

Yararl bilgi:Mikserileiinizsonaerdikten sonra,mikserihementemizlemeniziyiolur.

W Dikkat! Uygunolmayanbesinlercihazahasar verebilir.

70Czerindekiscakbesinlerikar trmakabndailemeyiniz.

Yeterlimiktardasvilekartrlarak ilenenkpbuzlarhariolmakzere, derindondurulmubesinlericihazile ilemeyiniz.

Sertparalarierengdamaddelerini cihazileilemeyiniz.ekirdeklivesert ekirdeklimeyveleri(elma,eftalivs.) ilemedenncemeyvelerinekirdeklerini kartnz.

Bilgiler lemeiinkstlamalar:

Badem,soan,maydanozveetgibi malzemeleriparalamaynz.

Mikserileyerfstezmesi,hindistan ceviziyaveyacevizpresigibirnler yaplamaz.

Sertbesinleriyeterincesvyla kartrnz.

Tozbiimindekibesinlerikartrmaile mindennceyeterincesvylakartrnz veyasviindetamamenznz.Toz besinlerernekolaraktozeker,kakao tozu,kavrulmusoyafasulyesi,un, proteintozuverilebilir.

Temizlik ve bakm Kullanlanaksesuarparalarher kullanmdansonraiyicetemizlenmelidir. X Tablo O Dikkat! Andrctemizlikmalzemeleri kullanmaynz.Yzeylerzarargrebilir.

Ana cihazn temizlenmesi W Elektrik arpma tehlikesi!

Anacihazkesinliklesuyasokmaynzve akansualtnatutmaynz.Temizlemeilemi iinbuharltemizlemecihazkullanmaynz.

Elektrikfiiniprizdenekipkartnz. Anacihazvetahriksistemikoruyucu kapannemlibirbezilesiliniz.Gere kirsebirazbulakdeterjankullannz.

Ardndancihazsilipkurulaynz.

Kartrma kabnn ve aletlerin temizlenmesi Kartrmakabvealetlerbulak makinesindeykanmayaelverilidir. Plastikparalarbulakmakinesine yerletirirkenskmamalarnadikkatediniz, aksihaldeykamailemisrasndakalc deformasyonlarszkonusuolabilir!

Doraycnn temizlenmesi W Keskin baklardan dolay yaralanma tehlikesi sz konusudur!

Elinizlekeskinbaklaravedoramadiskinin kenarlarnadokunmaynzvetutmaynz. Temizlemeilemiiinbirfrakullannz. Doraycnntmparalarbulakmakine sindeykanabilir. Yararl bilgi: rneinhavuilendikten sonracihazdaoluankrmzlekeleri temizlemekiinbirbezebirazsvyemek yadknzvebubeziledoraycy (doramadisklerihari)siliniz.Ardndan doraycyykaynz.

Mikserin temizlenmesi W Keskin baklar nedeniyle yaralanma

tehlikesi! Mikserinbaklarnaplakellerinizile dokunmaynz. Kartrmabarda,kapakvehunibulak makinesindeykanabilir. Yararl bilgi: Svmaddelerilealtktan sonramikserincihazdankartlmadan temizlenmesigenellikleyeterlidir. Bununiin,anacihazataklolanmiksere

164

tr Muhafaza

700mlbulakdeterjanlsudoldurunuz. Mikseriyakl.1dakikaaltrnz(kademe7). Deterjanlsuyudkpboaltnzvemikseri temizsuiledurulaynz. nemli bilgi: Aksesuarantasnihtiyacagre temizleyiniz.antaiindekibakmvekoruma bilgiveuyarlarnadikkatediniz.

Muhafaza W Yaralanma tehlikesi!

Cihazkullanlmadzaman,elektrikfiini prizdenekipkarnz. Resim K:

Aletlerivedoramadiskleriniaksesuar antasndamuhafazayerletiriniz.

Aksesuarantasnkabniinde muhafazaediniz.

Arza durumunda yardm W Yaralanma tehlikesi!

Birarzagidermealmasndannce elektrikfiiniprizdenekipkarnz. nemli bilgi: Cihaznkullanmsrasndahataolumas, elektroniksigortann/emniyetindevreye girmesiveyacihaznarzalanmashalinde, budurumalmagstergesininyanp snmesiilegsterilir. evirme kolu, her alma konumunda yerine oturmu olmaldr. Szkonusuolanproblemiilknceaadaki bilgileregregidermeyideneyiniz. Arza Cihazalmyor. zm

Elektrikakmbeslemesinikontrolediniz. Elektrikfiinikontrolediniz. evirmekolunukontrolediniz. Dorukonumdam?Yerineoturup kilitlenmimi?

Mikseriyadakartrmakabnsonuna kadareviripsknz.

Mikserkapantaknzvesonunakadar eviripsknz.

Kullanlmayantahriksistemlerinetahrik sistemikoruyucukapaklarntaknz.

Tekraralmaemniyetiaktiftir.Cihaz Pkonumunaalnzvesonra istediinizkademeyegerialnz.

Arza Cihazkullanmesnasndakapanyor.Ar yklenmeemniyetidevreyegirmi.Ayn andaokfazlabesinileallm. zm

Cihazkapatnz. lememiktarnazaltnz.

Arza Hareketetmekteolantahrikte(motorda) istenmedenkilitamatuunabaslmtr. evrilenkolyukardoruhareketediyor. Tahrik(motor)kapanyorancakalet deitirmepozisyonundadurmuyor. zm

Dneralteri0/off konumuna ayarlaynz.

evirmekolunu1 konumuna getiriniz.

Cihazdevreyesokunuz (kademe 1).

Cihaztekrarkapatnz. Alet,aletdeitirmepozisyonundadurur. Arza Mikseralmayabalamyorveya kullanmsrasndaduruyor,tahriksistemi homurduyor.Bakblokeedilmitir. zm

Cihazkapatnzveelektrikfiinipriziden ekipkartnz.

Miksericihazdankartnzveilgiliengeli kaldrnz.

Mikseritekrarcihazataknz. Cihazaltrnz.

nemli bilgi Arzagiderilemiyorsaltfenyetkiliservise bavurunuz.

165

tr Kullanmrnekleri

Kullanm rnekleri Tablo L, M ve N iindebelirtilengenel tavsiyeleridikkatealnz. zinverilenazamimiktarlaramaynz.

Biskvi hamuru Ana tarif 2 yumurta 2-3orbakascaksu 100geker 1paketvanilyaekeri 70 g un 70gniasta Gerekirsekabartmatozu Malzemeleri(unveniastahari)yak lak4-6dakika7kademesinderpma telikpklbirkvamagelinceyekadar ileyiniz.

Dneralteri1kademesineayarlaynz veelektengeirilmiolanunuve niastay,bukpkkvamndaki malzemeyeyaklak-1dakika ierisindekakkakilaveederek kartrnz.

Azami miktar:Temeltarifin2misli

Kek hamuru Ana tarif 6 yumurta 500geker 1 tutam tuz 2paketvanilyaekeri veyalimonunkabuu

500gtereyaveyamargarin (Odascaklnda)

1000 g un 1 paket kabartma tozu 250 ml st Yumurtalar,ekeri,tuzuvevanilya ekeriniveyalimonkabuunuyaklak 10saniyesresincekademe1derpc ilekartrn.

Kademe5eayarlaynveyaklak 120saniyeileyin.

Tereyaekleyinveyaklak60saniye kademe3teileyin.

Unvekabartmatozuekleyinveyaklak 2dakikakademe1deileyin.

Kademe3eayarlaynve2dakikaieri sindeyavayavastekleyin.

Azami miktar:1xtemeltarif

Ar meyveli kek Temeltarif 3 yumurta 135geker 135gmargarin 255 g un 10 g kabartma tozu 150gkuzm 150gkarkkurutulmumeyveler rpmatelinitaknz. Kurutulmumeyvelerharitmmalze meleridoldurunuz.

Malzemeleri30saniyesreylekademe1 ayarndaileyiniz.

Ardndan3-5dakikasreylekademe5 ayarndaileyiniz.

Cihazkademe2ayarnagetiriniz. 30-60saniyeierisindekurutulmu meyveleriilaveediniz.

Azami miktar:2xtemeltarif

Poaa hamuru Ana tarif 125gtereya (odascaklnda)

100-125geker 1 yumurta 1 tutam tuz Birazlimonkabuuveyavanilyaekeri 250 g un Gerekirsekabartmatozu Kartrmatelinikullanaraktmmalze meleriyakl.dakikasreylekademe 1ayarnda,ardndanyakl.3-6dakika sreyle kademe 3ayarndakartrnz.

250 g un ve sonra: Malzemelerinceyourmakancasile yaklakdakikakademe1dekartr nz.Sonrayaklak56dakika3kademe sindeyourmakancasileyourunuz.

Azami miktar:Temeltarifin2misli

166

tr zel aksesuar

Mayal hamur Ana tarif 500 g un 1 yumurta 80gkatya(odascaklnda) 80geker 200-250mllkst 25 g taze maya

veya 1 paket kuru (toz) maya limonunkabuu 1 tutam tuz Tmmalzemelerinceyaklakdakika kademe1dekartrnz.Sonrayaklak 3-6dakika3kademesindeyourma kancasilekartrnz.

Azami miktar:Temeltarifin2misli

Makarna hamuru Ana tarif 300 g un 3 yumurta htiyacagre,1-2orbaka(10-20g) souksu

Tmmalzemeleriyakl.3-5dakika3 kademedebirhamuroluacakekilde kartrnz.

Azami miktar:Temeltarifin1,5misli

Ekmek hamuru Anatarif 1000 g un 2 paket kuru maya 2aykatuz 600650mlscaksu Tmmalzemelerinceyaklakdakika kademe1dekartrnz.Sonrayaklak 67dakika3kademesindeyourma kancasilekartrnz.

Mayonez 1 yumurta 1aykahardal litresvya 1orbakalimonsuyuveyasirke 1 tutam tuz 1tutameker Malzemelerodascaklndaolmaldr. Mayonezhazrlanrkenmutlakayumurtalarn sarsvebeyazbirliktekullanlmaldr.

Malzemeleri(yahari)birkasaniye 3veya4kademesindemikseriinde ileyiniz.

Mikserikademe7eayarlaynz,ya yavayavahunizerindenmikserin iinedknzvemayonezgereken kvaramagelinceyekadarkartrnz.

Mayonezi ksa srede kullannz, fazla muhafaza etmeyiniz.

zel aksesuar zelaksesuarlarmterihizmetlerinden, bayilerdenveyainternettenteminedine bilirsiniz.Cihaznzlamkemmelbiruyum iindealacakekildetasarlandklarndan mutlakaorijinalaksesuarlarkullannz. Aksesuarcihazazeldir.Satnalrkenher zamancihaznzntamadn(E-Nr.)belirtiniz. Cihaznziinmevcutolanaksesuarlar kataloumuzdanveinternetmaazamzdan inceleyebilirveyamterihizmetlerine sorabilirsiniz. www.bosch-home.com

167

tr Eldenkartlmas

Elden kartlmas

J AEEE Ynetmeliine Uyum ve Atk rnn Elden karlmas Ambalaj malzemesini evre kural- larna uygun ekilde imha ediniz. Bu rn T.C. evre ve ehircilik Bakanl tarafndan yaymlanan Atk Elektrikli ve Elektronik Eyalarn Kontrol Ynetmeliinde belirtilen zararl ve yasakl maddeleri iermez.

AEEE ynetmeliine uygundur. Bu rn, geri dnml ve tekrar kullanla- bilir nitelikteki yksek kaliteli para ve mal- zemelerden retilmitir. Bu nedenle, rn, hizmet mrnn sonunda evsel veya dier atklarla birlikte atmayn. Elektrikli ve elektronik cihazlarn geri dnm iin bir toplama noktasna gtrn. Bu toplama noktalarn blgeniz- deki yerel ynetime sorun. Kullanlm rnleri geri kazanma vererek evrenin ve doal kaynaklarn korunmasna yardmc olun. rn atmadan nce ocuklarn gvenlii iin elektrik fiini kesin ve kilit mekanizma- sn krarak almaz duruma getirin.

Garanti Bu cihaz iin, yurt dndaki temsilcilikleri- mizin vermi olduu garanti artlar geerli- dir. Bu hususta daha detayl bilgi almak iin, cihaz satn aldnz satcya ba vurunuz. Garanti sresi ierisinde bu garantiden yarar- lanabilmek iin, cihaz satn aldnz gste- ren fii veya faturay gstermeniz arttr. Makinenizi daha verimli kullanabilmeniz iin:

Bu cihazlar ev tipi kullanma uygundur, endstriyel (sanayi tipi) kullanma uygun deildir.

Cihaz sadece tip levhasndaki bilgilere uygun bir ekilde elektrik prizine balayp altrnz.

Cihaznz kullanmayacaksanz, dmesinden kapatp kaldrnz.

Deiiklik haklar mahfuzdur.

170

pl Uytkowaniezgodnezprzeznaczeniem

Uytkowanie zgodne z przeznaczeniem Urzdzeniejestprzeznaczonewyczniedouytkuwgospodarstwie domowymipodobnychotoczeniach.Uywaurzdzeniatylkodo przetwarzaniaartykuwwilociachtypowychdlagospodarstw domowych i przez czas typowy dla gospodarstw domowych. Urzdzenienadajesidomieszania,zagniataniaorazubijania artykuwspoywczych.Urzdzenianiewolnouywado przetwarzaniainnychsubstancjiiprzedmiotw.Uyciedodatkowych akcesoriwzaaprobowanychprzezproducentaumoliwia dodatkowezastosowaniaurzdzenia.Urzdzeniauywatylko zzaaprobowanymi,oryginalnymiczciamiiakcesoriami.Nigdynie uywaakcesoriwprzeznaczonychdlainnychurzdze. Urzdzeniawolnouywatylkowpomieszczeniachprzy temperaturzepokojowejinawysokociniewikszejni2000mnad poziomem morza.

Wane wskazwki dotyczce bezpieczestwa Naleydokadnieprzeczytainstrukcjobsugi,stosowasido niejistaranniejprzechowywa!Przekazujcurzdzenieinnej osobienaleydoczydoniegoniniejszinstrukcj.Niestosowanie sidoinstrukcjiprawidowegokorzystaniazurzdzeniawyklucza odpowiedzialnoproducentazawynikestdszkody. Tourzdzeniemoebyobsugiwaneprzezosobyoograniczonych zdolnociachfizycznych,sensorycznychlubumysowych orazosobynieposiadajcewystarczajcegodowiadczeniai/ lubwiedzypodwarunkiem,epozostajonepodnadzorem lubzostaypouczoneosposobiebezpiecznegokorzystania zurzdzeniaizrozumiayzwizaneztymzagroenia.Nie dopuszczadziecidourzdzeniaiprzewoduzasilajcegoinie pozwalaimnaobsugiwanieurzdzenia.Dzieciomniewolno bawisiurzdzeniem.Dzieciomniewolnoczyciurzdzenia aniwykonywaprzewidzianychdlauytkownikaczynnoci konserwacyjnych.

W Niebezpieczestwo poraenia prdem i poaru! Urzdzenienaleypodczyiuytkowazgodniezparametrami podanyminatabliczceznamionowej.Urzdzeniamona uywatylkowtedy,gdyelektrycznyprzewdzasilajcyisamo urzdzenieniesuszkodzone.Abyuniknzagroe,naley zlecanaprawyurzdzenia,jaknp.wymianuszkodzonego przewoduzasilajcego,tylkonaszemuautoryzowanemu serwisowi.

171

pl Wanewskazwkidotyczcebezpieczestwa

Urzdzeniewczaiwyczatylkoprzecznikiemobrotowym. Nigdyniepodczaurzdzeniadoautomatycznychwycznikw czasowych lub do zdalnie sterowanych gniazdek sieciowych. Zawszenadzorowapracurzdzenia!

Niestawiaurzdzenianagorcychpowierzchniach,np.pytach grzewczychkuchenek,aniwichpobliu.Wykluczykontakt przewoduzasilajcegozgorcymielementamiiniecigngo przezostrekrawdzie.

Korpusuurzdzenianigdyniezanurzawwodzieaniniemy wzmywarcedonaczy.Niestosowamyjekparowych.Nigdynie uywaurzdzeniazmokrymirkami.

Urzdzeniemusibyodczaneodsiecipokadymuyciu, wraziebrakunadzoru,przedzoeniem,rozoeniem irozpoczciemczyszczeniaorazwprzypadkuwystpienia usterki. W Niebezpieczestwo zranienia!

Przedwymianakcesoriwlubczcidodatkowych,ktre znajdujsiwruchupodczaspracyurzdzenia,naley konieczniewyczyurzdzenieodczywtyczkodgniazda sieciowego.Powyczeniuurzdzenianapdpracujejeszcze przezkrtkiczas.Zaczeka,anapdcakowiciesizatrzyma.

Niezmieniapooeniaramieniaurzdzenia,jeeliurzdzenie jestwczone.

Narzdziauytkowatylkozzaoonmisk,pokryworaz zaoonymiosonaminapdu!Wprzypadkustosowania akcesoriw,misk,pokrywiosonnapdunaleyzakada zgodniezinstrukcj!

Podczaspracynigdyniewkadapalcwdomiski,anidootworu wsypowego.Niewkadaadnychprzedmiotw(np.chochli) domiskianidootworuwsypowego.Trzymazdalekaod obracajcychsiczcirce,wosy,odzieiinneutensylia.

Nieuywarwnoczenienarzdziaiakcesoriwlub2 akcesoriw.Przystosowaniuakcesoriwprzestrzega wskazwekzawartychwniniejszejinstrukcjiobsugioraz winstrukcjachobsugiakcesoriw.

Akcesoriwuywatylkopocakowitymzmontowaniu.Nie skadaprzystawkinakorpusieurzdzenia.Uywaakcesoriw tylko w odpowiedniej pozycji roboczej.

Niedotykaostrychnoyikrawdzitarczrozdrabniajcych. Tarczerozdrabniajcechwytatylkozabrzeg!

Niedotykanoymikseragoymirkoma. Nigdyniewkadarkdozaoonegomiksera!Nigdynieuywa mikserabezzaoonejpokrywy.

172

pl Wanewskazwkidotyczcebezpieczestwa

Naleyzachowywaostronopodczasobchodzeniasi zostryminoami,podczasoprnianiapojemnikaoraz czyszczenia. W Niebezpieczestwo oparzenia!

Podczasprzetwarzaniagorcychproduktwprzezlejekwpokrywie wydostajesipara.

W Niebezpieczestwo uduszenia! Niepozwaladzieciomnazabawopakowaniem.

W Uwaga! Zalecasiniepozostawiawczonegourzdzeniaduejnijestto koniecznedoobrbkiartykuwspoywczych. Niewczapustegourzdzenia.

W Wane! Urzdzenienaleykoniecznieczycipokadymuyciulubpo duszymokresienieuywania(X Czyszczenie i pielgnacja patrz  strona 179).

W Objanienie symboli na urzdzeniu lub akcesoriach

i Przestrzegawskazwekzawartychwinstrukcjiobsugi.

Y Ostronie!Obracajcesinoe.

W Ostronie!Obracajcesinarzdzia. Niewkadapalcwanirkwotwrdonapeniania.

Serdecznie gratulujemy Pastwu zakupu nowego urzdzenia marki Bosch. Dalsze informacje dotyczce naszych produktw znajd Pastwo na naszej stronie internetowej.

Spis treci Uytkowaniezgodne z przeznaczeniem...................................170 Wanewskazwkidotyczce bezpieczestwa ......................................170 Systemyzabezpieczajce ......................173 Opisurzdzenia......................................173 Pozycje robocze .....................................174 Obsuga ..................................................175 Czyszczenieipielgnacja ......................179 Przechowywanie.....................................180 Usuwanie usterek ...................................180 Przykadyzastosowa ...........................181 Akcesoria specjalne................................182 Ekologiczna utylizacja ............................183 Gwarancja ..............................................183

173

pl Systemyzabezpieczajce

Systemy zabezpieczajce Blokada wczenia Patrz tabela Pozycje robocze. Urzdzeniedajesiwczawpozycjach1 i 3 tylko:

gdymiska(11)jestzaoonaiobrcona wzablokowanepooenie.

Zabezpieczenie przed ponownym wczeniem Wprzypadkuprzerwywdopywieprdu urzdzeniepozostajewczone,alepo przywrceniu zasilania silnik nie zaczyna ponowniepracowa.Wceluponownego wczeniaurzdzeniaustawiprzecznik obrotowy na 0/off,anastpniewczy urzdzenie.

Zabezpieczenie przed przecieniem Jeelipodczaspracyurzdzeniasilnik wyczysisamoczynnie,oznaczato, ezadziaabezpiecznikprzecieniowy. Moliwprzyczynmoebyjednoczesne przetwarzaniezbytduejilociartykuw spoywczych. Sposb postpowania w przypadku zadziaania jednego z systemw zabez- pieczajcych opisany jest w rozdziale Usuwanie drobnych usterek. Urzdzenieniewymagakonserwacji.

Opis urzdzenia Rysunek A: Korpus urzdzenia 1 Przycisk zwalniajcy 2 Rami urzdzenia

FunkcjaEasyArmliftwspierajca ruchramieniaurzdzeniawgr(patrz Pozycje robocze).

3 Przecznik obrotowy Powyczeniu(pooenie0/off) urzdzeniepracujejeszczechwil izatrzymujesiautomatyczniew optymalnejpozycjiwymianynarzdzi. 0/off = stop M=impulsowewczanieznajwysz prdkociobrotow,przytrzymywa przez potrzebny czas. Poziomy 1-7,prdkopracy: 1=niskaprdkoobrotowawolna, 7=wysokaprdkoobrotowa szybka.

4 Wskanik pracy wiecipodczaspracy(przecznik obrotowy w pozycji M lub 1-7). Migawprzypadkibdnejobsugi urzdzenia,zadziaaniubezpiecznika elektronicznego lub uszkodzenia urzdzenia,patrzrozdziaUsuwanie drobnych usterek.

5 Osona napdu Wceluzdjciaosonynapdunacisn natylnczpokrywy,anastpnie zdjpokryw.

6 Napd rozdrabniacza oraz wyciskarki do owocw cytrusowych (akcesoria dodatkowe*). Jeelinapdniejestuywany,naley zaoyosonnanapd.

7 Napd narzdzi (kocwkidomieszaniaidoubijania, hak do zagniatania) oraz przystawki do mielenia misa (akcesoria dodatkowe*)

8 Osona napdu miksera 9 Napd miksera (akcesoria

dodatkowe*) Jeelimikserniejestuywany,naley zaoyosonnapdumiksera.

10 Automatyczny zwijacz kabla Miska z akcesoriami 11 Miska do mieszania ze stali

nierdzewnej 12 Pokrywa

174

pl Pozycje robocze

Narzdzia 13 Profesjonalna kocwka do

mieszania Profi Flexi 14 Profesjonalna kocwka do ubijania 15 Hak do zagniatania z odgarniaczem

ciasta 16 Torba na akcesoria

Doprzechowywanianarzdziitarcz rozdrabniajcych.

Rozdrabniacz 17 Popychacz 18 Pokrywa z otworem do napeniania 19 Tarcze rozdrabniajce

a Profesjonalna tarcza dwustronna do krojenia na grube i cienkie plasterki Profi Supercut

b Tarcza dwustronna do wirkowania grubo/drobno

c Tarcza do tarcia drobno d Tarczadwustronna,tncana

plasterki/wirki* 20 Uchwyt tarcz 21 Obudowa z otworem wyrzutowym Mikser* 22 Dzbanek do miksowania 23 Pokrywa 24 Lejek *Jeelijakielementwyposaenianie naleydozakresudostawy,monago nabywhandlulubzaporednictwem naszego serwisu.

Pozycje robocze Rysunek B: Uwaga! Urzdzeniewczatylko,gdynarzdzie/ akcesoriaszamocowanewsposbpoka zanywtabelinaodpowiednimnapdzie iwewaciwejpozycjiorazustawionew pozycjiroboczej.Ramiurzdzeniamusi byzablokowanewkadejpozycjiroboczej. Wskazwka Ramiurzdzeniajestwyposaone wfunkcjEasyArmliftwspierajcruch ramieniawgr.

Ustawianie pozycji roboczej: Nacisnprzyciskzwalniajcyblokad iobrciramiurzdzenia.Wspomaga ruchrk.

Przesunramiurzdzeniawdane pooeniedomomentujegosamoczyn nego zablokowania.

Pozycja Napd Narz- dzie / akcesoria

Prdko robocza

1 7

17

15

13

2 7 *

3 6 37

35

4

9 57

7 57

*Wkadanie/wyjmowaniekocwkido ubijania,kocwkidomieszaniaihakado zagniatania.

175

pl Obsuga

Obsuga W Niebezpieczestwo zranienia!

Podczywtyczkdogniazdasiecio wegodopieropozakoczeniuwszystkich przygotowa. Uwaga! Urzdzeniauywatylkoakcesoriami/ narzdziamiwodpowiedniejpozycjirobo czej.Niewczapustegourzdzenia.Nie naraaurzdzeniaiakcesoriwnadziaa nieciepa.Elementyniesprzystosowane do kuchenki mikrofalowej.

Urzdzenieiakcesorianaleyprzed pierwszymuyciemdokadniewyczy ci,patrzCzyszczenieurzdzenia.

Przygotowania Postawikorpusurzdzenianagadkiej

i czystej powierzchni. Wysunkabeljednympocigniciem nadandugo(maks.100cm) ipowolipuci;kabelzostajezabloko wany (rysunek C).

Zmniejszaniedugociwycignitego kabla:lekkopocignizwolnikabel, abyzwinsinadandugo. Nastpnieponownielekkopocign ipowolipucikabel;kabeljestzostaje zablokowany.

Uwaga! Jeelikabelsizablokuje,naleygocako wiciewycignipowolipuszcza,abysi zwin.

Podczywtyczkdogniazda sieciowego.

Miska i narzdzia Proszsizapoznazmoliwymizastoso waniami opisanymi w tabeli. L

W Niebezpieczestwo zranienia przez obracajce si narzdzia! Podczaspracyurzdzenianigdynie wkadapalcwanirkdomiski.Pracowa tylkozzaoonpokryw(12)! Narzdziawymieniatylkopowyczeniu izatrzymaniusinapdupowyczeniu urzdzenianapdpracujejeszczeprzez krtkiczasizatrzymujesiwpozycji wymianynarzdzi.

Ramiurzdzeniaokrcadopieropo zatrzymaniusinarzdzia. Zawszeosanianieuywanenapdy osonami. Uwaga! Miskiuywatylkorazemztym urzdzeniem. Profesjonalna kocwka do mie- szania Profi Flexi (13) do mieszania ciast, takich jak np. ciasta na placek, na placki owocoweorazmieszaniaskadnikwtakich jakrodzynkiczykawaeczkiczekolady Profesjonalna kocwka do ubi- jania (14) doubijaniabiakaimietany(o zawartociconajmniej30% tuszczu)idomieszaniamasybiszkoptowej Hak do zagniatania (15) do zagniatania ciasta, np. cista drodowego,chlebowego,na pizz,namakarony,nawypieki orazdomieszaniaskadnikwtakichjak nasiona z ciastami Wana wskazwka dotyczca uywania kocwki do ubijania (rysunek D): Kocwkadoubijaniaoptymalniemiesza skadniki,gdyjestustawionawminimalnej moliwejodlegocioddnamiski,prawie jejdotykajc.Jeelitakniejest,naley dopasowawysokokocwkidoubijania wnastpujcysposb:

Odczywtyczkurzdzeniaod gniazda sieciowego.

Nacisnprzyciskzwalniajcy blokadiustawiramiurz dzenia w pozycji 2.

Wsunkocwkdoubijania doelementunapdowegotak,by zostaasamoczynniezablokowana.

Przytrzymakocwkdoubijaniai poluzowanakrtkkluczempaskim(nr 8) w kierunku ruchu wskazwek zegara.

176

pl Obsuga

Ustawioptymalnwysokokocwki do ubijania przez jej odpowiednie obr cenie: obracanie w kierunku ruchu wskazwek zegara: podnoszenie. obracanie w kierunku przeciwnym do kierunku ruchu wskazwek zegara: opuszczanie

Nacisnprzyciskzwalniajcy blokadiustawiramiurz dzenia w pozycji 1.

Sprawdziiwraziepotrzeby skorygowawysokokocwkido ubijania.

Jeeliwysokojestustawiona prawidowo,nacisnprzycisk zwalniajcyblokadiustawi ramiurzdzeniawpozycji2.

Przytrzymakocwkdoubijaniai dokrcinakrtkkluczempaskim(nr 8) w kierunku przeciwnym do kierunku ruchu wskazwek zegara.

Praca z misk i narzdziami (rysunek E): Nacisnprzyciskzwalniajcy blokadiustawiramiurz dzenia w pozycji 2.

Wkadaniemiski: Zaoyprzechylondoprzodumiski osadzi,obrciwkierunkuprzeciwnym do kierunku ruchu wskazwek zegara tak,bysamoczynniesizablokowaa.

Wzalenociodzadaniawsunko cwkdomieszania,kocwkdoubi janialubhakdozagniataniadonapdu tak,bysamoczynniesizablokoway.

Wskazwka: Przyzakadaniuhakadozagniatania obrciodgarniaczciasta,abyhakmgsi zablokowa(rysunek E-4b).

Woydomiskiskadnikiprzeznaczone do przetworzenia.

Nacisnprzyciskzwalniajcy blokadiustawiramiurz dzenia w pozycji 1.

Zaoypokryw. Ustawiaprzecznikobrotowyna danypoziom.

Dodawanie skadnikw Wyczyurzdzenieprzecznikiem

obrotowym. Dodawaskadnikiprzezotwr

w pokrywie. lub

Zdjpokryw. Nacisnprzyciskzwalniajcy blokadiustawiramiurz dzenia w pozycji 2.

Woyskadniki. Po zakoczeniu pracy

Wyczyurzdzenieprzecznikiem obrotowym.

Odczywtyczkurzdzeniaod gniazda sieciowego.

Zdjpokryw. Nacisnprzyciskzwalniajcy blokadiustawiramiurz dzenia w pozycji 2.

Wyjnarzdzieznapdu. Zdjmisk. Oczyciwszystkieczci,patrzroz dziaCzyszczenieipielgnacja.

Rozdrabniacz Proszsizapoznazmoliwymizastoso waniami opisanymi w tabeli. M

W Niebezpieczestwo zranienia! Niedotykaostrychnoyikrawdzitarcz rozdrabniajcych. Tarczerozdrabniajcechwytatylkoza brzeg! Rozdrabniaczzakadaizdejmowatylko, gdyurzdzeniejestwyczoneanapd zatrzymany. Niewkadapalcwwotwrdonapeniania. Uwaga! Rozdrabniaczamonauywatylko,gdy jest kompletnie zmontowany. Nie wolno skadarozdrabniaczanakorpusieurz dzenia.Rozdrabniaczuytkowatylko w przedstawionych pozycjach roboczych.

177

pl Obsuga

Ochrona przed przecieniem Rysunek F: Wanapdowyrozdrabniaczawyposaony jestwnacicie(miejsceprzewidzianego przeomu)zapobiegajcepowaniejszemu uszkodzeniuurzdzeniawprzypadkuprze cieniarozdrabniacza.Wrazieprzecie niawanapdowyamiesiwtymmiejscu. Nowyuchwyttarczwrazzwaemnapdo wymmonanabywserwisie. Profesjonalna tarcza dwustronna do krojenia na grube i cienkie plasterki Profi Supercut do krojenia na cienkie i grube plasterki arty kuwspoywczych,takichjaknp.owocei warzywa. Oznaczenie:

due=grubeplasterki mae=cienkieplasterki

Wskazwka:Nienadajesidoprze twarzaniatwardychserw,chleba,buek i czekolady. Rada:Gotowaneziemniakikroidopieropo wystygniciu. Tarcza dwustronna do wirkowania grubo/drobno do wirkowania na grube lub drobne kawakiartykuwspoywczych,takichjak np. owoce, warzywa albo sery takie jak gouda czy edamer. Oznaczenie:

2 = strona gruba 4 = strona drobna

Wskazwka:Nienadajesidoprzetwa rzania orzechw i twardych serw, np. parmezanu. Rada:Mikkieserytrzeprzyuyciustrony do grubego wirkowania. Tarcza do tarcia drobno do drobnego wirkowania takich artykuwspoywczychjaknp.orzechyi twardesery,naprzykadparmezan. Wskazwka:Nienadajesidoprzetwarza niaserwmikkichiserwwplasterkach.

Tarcza dwustronna, tnca na plasterki/wirki do tarcia surowych ziemniakw lub krojenia w plasterki. Wskazwka:Nienadajesidoprzetwarza niawknistychartykuwspoywczych,np. porw czy mango. Praca z rozdrabniaczem Rysunek G:

Nacisnprzyciskzwalniajcy blokadiustawiramiurz dzenia w pozycji 2.

Wkadaniemiski: Zaoyprzechylondoprzodumiski osadzi,obrciwkierunkuprzeciwnym do kierunku ruchu wskazwek zegara tak,bysamoczynniesizablokowaa.

Nacisnprzyciskzwalniajcy blokadiustawiramiurz dzenia w pozycji 3.

Zdjosonznapdurozdrab niacza (rysunek G-5a).

Przytrzymauchwyttarczzadolny koniec;obieostrekocwkimuszby przy tym skierowane do gry.

Zaoyostroniedantarczdo krojenialubtarcianakocwkiuchwytu tarczy (rysunek G-6a). W przypadku tarcz dwustronnych zwrciuwag,bydanastronabya skierowana do gry.

Chwyciuchwyttarczzagrnykoniec iwoydoobudowy(rysunek G-6b).

Zaoypokryw(zwrciuwagna oznaczenia)iobrcijdooporuwkie runku ruchu wskazwek zegara.

Zaoyrozdrabniaczwsposb pokazany na rysunku G-8nanapd iobrcidooporuwkierunkuruchu wskazwek zegara.

Ustawiprzecznikobrotowynazale cany poziom.

Produkty przeznaczone do przetworze niawkadaprzezotwrdonapeniania ipopychapopychaczem.

Uwaga! Unikanagromadzeniaproduktw w otworze wylotowym.

178

pl Obsuga

Wskazwka:cienkieproduktykroi wwizkach,zapewnitoichrwnomierne rozdrobnienie. Wskazwka:jeeliproduktyzablokujsi wrozdrabniaczu,naleywyczyrobot kuchenny,odczywtyczkodgniazda sieciowego,odczekanacakowitezatrzy manieurzdzenia,zdjpokrywrozdrab niaczaioprniotwrdonapeniania. Po zakoczeniu pracy

Wyczyurzdzenieprzecznikiem obrotowym.

Obrcirozdrabniaczwkierunkuprze ciwnym do kierunku ruchu wskazwek zegaraizdj.

Obrcipokrywwkierunkuprzeciw nym do kierunku ruchu wskazwek zegaraizdj.

Zdjuchwyttarczwrazztarcz.Wtym celunacisnpalcemoddounawa napdowy(rysunek H).

Wyczyciczci.

Mikser Proszsizapoznazmoliwymizastoso waniami opisanymi w tabeli. N

W Niebezpieczestwo skaleczenia przez ostre noe i obracajcy si napd! Nigdyniewkadarkdozaoonego miksera!Mikserzakada/zdejmowatylko, gdynapdjestzatrzymany!Miksermona wczatylkopocakowitymzmontowaniu izzaoonpokryw.Niewczapustego miksera.

W Niebezpieczestwo oparzenia! Podczasprzetwarzaniagorcychproduk twprzezlejekwpokrywiewydostajesi para. Praca z mikserem Rysunek J:

Nacisnprzyciskzwalniajcy blokadiramiurzdzenia odchyliwpooenie4.

Zdjosonnapdumiksera.

Zaoypojemnikmiksera(zgra oznaczenie na uchwycie z oznaczeniem nakorpusieurzdzenia)iobrcigo do oporu w kierunku przeciwnym do kierunku ruchu wskazwek zegara.

Woyskadniki. Maksymalnailopynnychskadnikw =1,25litra;maksymalnailopieni cychsilubgorcychpynw=0,75 litra.

Zaoypokrywiobrciwkie runku przeciwnym do kierunku ruchu wskazwek zegara do oporu wuchwyciemiksera.Pokrywamusiby zablokowana.

Ustawiaprzecznikobrotowyna danypoziom.

Dodawanie skadnikw Rysunek J-8:

Wyczyurzdzenieprzecznikiem obrotowym.

Zdjpokrywidodaskadniki lub

Wyjlejekzpokrywyidodawastae skadnikistopniowoprzezotwrdo napeniania

lub Dodawapynneskadnikiprzezlejek.

Po zakoczeniu pracy Wyczyurzdzenieprzecznikiem

obrotowym. Obrcimikserwkierunkuzgodnym

z kierunkiem ruchu wskazwek zegara izdj.

Wskazwka:mikserwyczycinajlepiej zarazpouyciu.

W Uwaga! Nieodpowiednieartykuyspoywczemog spowodowauszkodzenieurzdzenia.

Nieprzetwarzawdzbankumiksera gorcychproduktwspoywczych, ktrych temperatura przekracza 70C.

Nieprzetwarzazamroonychartyku w,zwyjtkiemkostekloduumieszczo nychwdostatecznejilocipynu.

179

pl Czyszczenieipielgnacja

Nieprzetwarzaartykuwspoywczych zawierajcychtwardeczci.Przed przetworzeniem owocw pestkowych (jabek,brzoskwiitp.)naleyusun pestki.

Wskazwki Ograniczenia przetwarzania:

Nierozdrabniatakichskadnikwjak migday,cebula,natkapietruszkilub miso.

Mikserniemoebyuywanydo sporzdzaniapastimusw,np.masa orzechowego lub kokosowego czy musu owocowego.

Artykuyspoywczeokonsystencjistaej mieszazawszezodpowiedniiloci pynu.

Przedmiksowaniemwymieszaspro szkowaneartykuyspoywczezwystar czajcilocipynulubcakowicie rozpucisiwpynie.Sproszkowane artykuyspoywczetonp.cukierpuder, kakaowproszku,praonasoja,mka, biakowproszku.

Czyszczenie i pielgnacja Pokadymuyciuakcesorianaleydokad niewyczyci. X Tabela O Uwaga! Niestosowaszorujcychrodkw czyszczcych.Moliwouszkodzenia powierzchni.

Czyszczenie korpusu urzdzenia W Niebezpieczestwo poraenia

prdem! Korpusuurzdzenianigdyniezanurza wwodzieaniniemypodbiecwod. Nieuywamyjekparowych.

Odczywtyczkurzdzeniaod gniazda sieciowego.

Korpusurzdzeniaiosonnapdu wycieratylkowilgotnciereczk. Wraziepotrzebyuyniecopynudo mycianaczy.

Nastpniewytrzeurzdzeniedosucha.

Czyszczenie miski i narzdzia Miskinarzdziamonamywzmywarce donaczy.Zwrciuwagnato,bynie zaciskaelementwztworzywasztucznego wzmywarce,poniewamogulectrwaej deformacji podczas zmywania!

Czyszczenie rozdrabniacza W Niebezpieczestwo zranienia ostrymi noami!

Niedotykaostrychnoyikrawdzitarcz rozdrabniajcych.Doczyszczeniauywa szczoteczki. Wszystkieczcirozdrabniaczamonamy wzmywarcedonaczy. Wskazwka:wceluusuniciaczerwonego osadu po przetwarzaniu np. marchewki, przetrzeczcirozdrabniacza(zwyjtkiem tarczrozdrabniajcych)ciereczknas czonkilkomakroplamiolejuspoywczego. Nastpnieumyrozdrabniacz.

Czyszczenie miksera W Niebezpieczestwo zranienia ostrymi

noami! Niedotykanoymikseragoymirkoma. Pojemnikmiksera,pokrywilejekmona mywzmywarcedonaczy. Wskazwka:poprzetwarzaniupynw czstowystarczywyczyszczeniemiksera bezzdejmowaniagozkorpusuurzdzenia. Wtymceluwla700mlwodyzkroplpynu domycianaczydozaoonegomiksera. Wczymiksernaok.1minuty(poziom7). Nastpniewylawodiwypukamikser czystwod. Wana wskazwka: Wraziepotrzebywyczycitorbnaakce soria.Przestrzegawskazwekdotycz cychczyszczeniaznajdujcychsiwtorbie na akcesoria.

180

pl Przechowywanie

Przechowywanie W Niebezpieczestwo zranienia!

Jeeliurzdzenieniejestuywane, naleyodczyjegowtyczkodgniazda sieciowego. Rysunek K:

Narzdziaitarczerozdrabniajceumie ciwtorbienaakcesoria.

Torbzakcesoriamiprzechowywa w misce.

Usuwanie usterek W Niebezpieczestwo zranienia!

Przedprzystpieniemdousuwaniausterek naleyzawszeodczywtyczkod gniazda sieciowego. Wana wskazwka: Lampka kontrolna miga w przypadku bdnejobsugiurzdzenia,zadziaaniu bezpiecznika elektronicznego lub uszkodze niaurzdzenia. Rami urzdzenia musi by zabloko- wane w kadej pozycji roboczej. Prosznajpierwsprbowausun wystpujcyproblemwoparciuoniniejsze wskazwki. Usterka Urzdzenieniezaczynapracowa. Sposb usunicia

Sprawdzizasilanieprdem elektrycznym.

Sprawdziwtyczksieciow. Sprawdziramiurzdzenia. Prawidowapozycja?Zablokowane?

Obrcimikserlubmiskdooporu. Zaoypokrywmikseraiobrcido

oporu. Zaoyosonynanieuywanenapdy. Zabezpieczenie przed ponownym wczeniemjestaktywne.Ustawiurz dzenie na 0/off,anastpnieponownie obrcinadanypoziom.

Usterka Urzdzeniewyczasipodczaspracy. Systemzabezpieczajcyprzedprzeci eniemjestaktywny.Woonozaduo produktwspoywczychnaraz. Sposb usunicia

Wyczyurzdzenie. Zmniejszyiloprzetwarzanych skadnikw.

Usterka Podczaspracynapduzostaprzypadkowo nacinityprzyciskzwalniajcyblokad. Ramiurzdzeniapodnosisidogry. Napdwyczasi,aleniezatrzymujesi wpozycjiwymianynarzdzia. Sposb usunicia

Ustawiprzecznikobrotowyna 0/off. Ustawiramiurzdzenia

w pozycji 1. Wczyurzdzenie(poziom1). Ponowniewyczyurzdzenie.

Narzdziezatrzymujesiwpozycji wymianynarzdzi. Usterka Mikserniezaczynapracowaalbozatrzy mujesipodczaspracy,anapdbrzczy. Zablokowanyn. Sposb usunicia

Wyczyurzdzenieiodczywtyczk od gniazda sieciowego.

Zdjmikseriusunprzyczynzablo kowanianoa.

Ponowniezaoymikser. Wczyurzdzenie.

Wana wskazwka Jeeliusterkiniemonausunwopisany tutajsposb,naleysizwrcidonaszego serwisu.

181

pl Przykadyzastosowa

Przykady zastosowa Stosowasidooglnychzalecezawar tych w tabelach L, M i N. Nieprzekraczamaksymalnejdopuszczal nejilociproduktw.

Ciasto biszkoptowe Przepis podstawowy 2 jajka 2-3ykigorcejwody 100 g cukru 1 opakowanie cukru waniliowego 70gmki 70gmkiziemniaczanej ewentualnie proszek do pieczenia Podaneskadniki(oprczmkiimki ziemniaczanej)ubijakocwkdo ubijania przez ok. 46 minut na zakresie 7,adomocnegospienienia.

Ustawiprzecznikobrotowynazakres 1idodajcykprzezotwrwsypowy przesianmkimkziemniaczan mieszadalejprzezok.do1minuty.

Maksymalna ilo: 2 x przepis podstawowy

Ciasto ucierane Przepis podstawowy 6 jajek 500 g cukru 1 szczypta soli 2 torebki cukru waniliowego lub otarta

skrka z cytryny 500gmasalubmargaryny

(o temperaturze pokojowej) 1000gmki 1 torebka proszku do pieczenia 250 ml mleka Jajka, cukier, sl i cukier waniliowy lub skrkzcytrynymieszakocwk do mieszania przez ok. 10 sekund na zakresie 1.

Ustawinazakres5imieszaprzez ok. 120 sekund.

Dodamasoimieszaprzez ok. 60 sekund na zakresie 3.

Dodamkorazproszekdopieczenia imieszaprzezok.2minutyna zakresie 1.

Przestawinazakres3iprzez2minuty dodawastopniowomleko.

Maksymalna ilo: 1 x przepis podstawowy

Cikie ciasto owocowe Przepis podstawowy 3 jaja 135 g cukru 135 g margaryny 255gmki 10 g proszku do pieczenia 150 g rodzynek korynckich 150 g mieszanych owocw suszonych Zaoykocwkdomieszania. Woywszystkieskadnikizwyjtkiem

suszonych owocw. Miksowaprzez30sekundna

poziomie 1. Nastpnieprzetwarzaprzez3-5minut

na poziomie 5. Ustawinapoziom2. Wcigu30-60sekunddodasuszone

owoce. Maksymalna ilo: 2 x przepis podstawowy

Ciasto kruche Przepis podstawowy 125gmasa

(o temperaturze pokojowej)

100125 g cukru 1 jajko 1 szczypta soli trochotartejskrkicytrynowejlub

cukru waniliowego 250gmki ewentualnie proszek do pieczenia Wszystkieskadnikimieszakocwk

do mieszania przez ok. minuty na poziomie1,nastpnieprzezok.3-6 minut na poziomie 3.

Powyej250gmki: Skadnikimieszahakiemdozagniata

nia przez ok. minuty na zakresie 1, nastpnieok.56 minuty na zakresie 3.

Maksymalna ilo: 2 x przepis podstawowy

182

pl Akcesoria specjalne

Ciasto drodowe Przepis podstawowy 500gmki 1 jajko 80gtuszczu(otemperaturze

pokojowej) 80 g cukru 200250 ml letniego mleka 25gwieychdrodylub1paczka drodysuszonych

otarta skrka z cytryny 1 szczypta soli Podaneskadnikimieszahakiemdo

zagniatania przez ok. minuty na zakresie1,nastpnieprzezok.3-6 minut na zakresie 3.

Maksymalna ilo: 2 x przepis podstawowy

Ciasto na makaron Przepis podstawowy 300gmki 3 jajka wraziepotrzeby1-2ykistoowe

(1020 g) zimnej wody Wszystkieskadnikizagniatanaciasto

przez ok. 3 do 5 minut na zakresie 3. Maksymalna ilo: 1,5 x przepis podstawowy

Ciasto chlebowe Przepis podstawowy 1000gmki 2 opakowania suszonych drody

2yeczkisoli 600650mlciepejwody Podaneskadnikimieszahakiemdo

zagniatania przez ok. minuty na zakresie1,nastpnieprzezok.67 minut na zakresie 3.

Majonez 1 jajo 1yeczkimusztardy l oleju 1ykasokucytrynowegoluboctu 1 szczypta soli 1 szczypta cukru Skadnikimuszmietemperaturpoko jow.Przygotowywaniemajonezujest moliwetylkozuyciempenychjaj.

Skadniki(oprczoliwy)miksowakilka sekund w mikserze na zakresie 3 lub 4.

Nastpnieprzeczymikserna zakres7,dolewapowolioliwprzez lejekitakdugomiksowa,apowstanie emulsja majonezu.

Majonez spoy w krtkim czasie nie przechowywa.

Akcesoria specjalne Akcesoriaspecjalnemonanabyw serwisie, w sklepach specjalistycznych lub przezInternet.Uywatylkooryginalnych akcesoriw,sonedokadniedostosowane doposiadanegourzdzenia. Akcesoriasprzeznaczonedlakonkretnych urzdze.Przyzakupienaleyzawsze podawadokadneoznaczenie(E-Nr.) urzdzenia. Informacjenatematakcesoriwdostp nychdlaposiadanegourzdzeniamona uzyskawsklepieinternetowymlubw serwisie. www.bosch-home.com

183

plEkologiczna utylizacja

Ekologiczna utylizacja

J To urzdzenie jest oznaczone zgodnie z Dyrektyw Europejsk 2012/19/UE oraz polsk Ustaw z dnia 11 wrzesnia 2015 r. O zuytym sprzcie elek- trycznym i elektronicznym (Dz.U. z dn. 23.10.2015 poz. 11688) symbolem przekrelonego kontenera na odpady. Takie oznakowanie informuje, e sprzt ten, po okresie jego uytko- wania nie moe by umieszczany cznie z innymi odpadami pocho- dzcymi z gospodarstwa domowego. Uytkownik jest zobowizany do oddania go prowadzcym zbieranie zuytego sprztu elektrycznego i elektronicznego. Prowadzcy zbie- ranie, w tym lokalne punkty zbirki, sklepy oraz gminne jednostka, tworz odpowiedni system umoliwiajcy oddanie tego sprztu. Waciwe postpowanie ze zuytym sprztem elektrycznym i elektronicznym przy- czynia si do uniknicia szkodliwych dla zdrowia ludzi i rodowiska natu- ralnego konsekwencji, wynikajcych z obecnoci skadnikw niebezpiecz- nych oraz niewaciwego skadowania i przetwarzania takiego sprztu.

Gwarancja Urzdzenie objte gwarancj. Dystrybutor/ gwarant: BSH Sprzt Gospodarstwa Domo- wego Sp. z o.o., Al. Jerozolimskie 183, 02-222 Warszawa. Czas trwania gwarancji: 24 miesice od wydania rzeczy pierwszemu kupujcemu. Terytorialny zasig ochrony gwarancyjnej: Polska. Konieczny dowd zakupu. Uprawnienia przysugujce kupu- jcemu: usunicie wady fizycznej, a jeeli to nie jest moliwe dostarczenie rzeczy wolnej od wady. Gwarancja nie wycza, nie ogranicza ani nie zawiesza uprawnie kupujcego wynikajcych z przepisw o rkojmi za wady rzeczy sprzedanej. Dalsza tre owiadczenia gwarancyjnego (wraz z wyczeniami z napraw gwaran- cyjnych) dostpna na stronie internetowej: www.bosch-home.pl/gwarancja. Gwarant udostpni tre owiadczenia gwarancyj- nego rwnie na pimie lub e-mailem w tym celu oraz w celu skorzystania z uprawnie z gwarancji prosimy o kontakt z infolini: +48 42 271 5555 (opata wg. stawek operatora).

Zmiany zastrzeone.

184

uk

. . , . . . . . 2000.

, ,! ,. , ., ,, . ,. . .

W !

,. , -. , , .

.

. !

185

uk

,., . .

.. ,.

:;, ; . W ! !

, , . ..

,. , , ! ,!

. (.,). ,, ,.

2. ,.

.. .

H. !

H. ! .

, . W !

.

186

uk

Bosch. .

...........184 ......................184 ...................................186 .......................................187 .................................188 .............................................188 .............................192 .............................................193 ......................193 ......................194 ...........................196 ..............................................196 .......................................196

W ! .

W ! ,. .

W ! , (X     . . 192).

W

i .

Y !.

W !. H.

.. 13, :

(11) .

, . 0/off, .

, . .

187

uk

. . .

A: 1 2

EasyArmlift (. ).

3 (0/off) . 0/off= M= ; , . 1-7,: 1=- , 7=- .

4 ( M1-7). , ,. .

5 , .

6 (*). , .

7 (-,-, ) (*)

8 9 (

*) , .

10

11 12 13 - Profi Flexi 14 - Profi 15

16

.

17 18 19

a ProfiSupercut /

b /

c - d -

* 20 21 * 22 23 24 *, , .

188

uk

B: ! , / . . sy rmlft,.

. .

.

/

1 7

17

15

13

2 7 *

3 6 37

35

/

4

9 57

7 57

*/- ,- .

W !

! , . ! / . . . .

, ..

.

(.100) ; (. C).

, . ; .

! , , .

.

189

uk

..L

W ! . (12)! - . . ,, . ! . - Profi Flexi (13) , , , , - Profi (14) ( 30%), (15) , ,, ,, ,- - (. D) - ., -, .

. 2.

- .

- (8).

-, . :. :.

1.

- ,.

, 2.

-, (8).

(. E) 2.

: ,, ; .

-, - .

, (. E-4b).

.

1.

.

190

uk

.

.

.

. 2.

.

.

. . 2.

. . ,. .

..M

W ! . ! / . . ! . . .

F: , (). . . Profi Supercut - / , :

Grob= Fein=

: , ,,. : ,. / ,, ,. :

2= 4=

: , , . : . - ,, -. :, . - .

191

uk

:, , . G:

2.

: ,, ; .

3.

(. G-5a).

; .

(. G-6a). , .

(. G-6b).

(.) .

, . G-8, .

.

, .

! . : .

: ,, , .

.

.

.

. (. H).

.

..N

W /, ! ! / ! . .

W ! . J:

4.

.

( ) .

. := 1,25;= 0,75.

192

uk

. .

.

J-8:

.

.

.

.

: .

W ! .

70C.

, .

, . (, ) .

:

, ,,.

,- ,.

.

. , ,, -,,, .

. XO ! . .

W

! . .

. . .

.

. ; !

W H !

H . . .

193

uk

: ( ). .

W

! . , . : , . 700 . 1(7). . . ,.

W !

! , . K:

.

.

W !

! , .

, . . , , . .

. . . ? ?

.

.

,.

. 0/off, .

. . .

. .

. . , .

194

uk

0/off.

1.

(1). .

. , ..

.

. . .

, .

.L, MN. .

2 2-3.. 100 1 70 70 () .4-6 -7.

1 .-1.

:2

6 500 1 2

500 ()

1000 1 250 ,, - 1 10.

5 120.

603.

. 21.

3 2 .

: 1

3 135 135 255 10 150 150 -. , .

301. 35 5.

2. 3060 .

:2x

195

uk

125 ( )

100-125 1 1

250 1, 363 -.

250: . 1,.56 3.

:2 500 1 80() 80 200-250 251

1 . 1,.3-6 3.

:2

300 3 1-2..(10-20)

. 3-53.

:1,5

1000 2 2..i 600650 . 1,.67 3.

1 1.. 1.. 1 1 . .

() 3 4.

7 , .

, .

196

uk

, . , . . (E-Nr.) . ,- . www.bosch-home.com

J 2012/19/EU , (waste electrical and electronic equipment WEEE). - , , . .

, , . - , , . . , . - .

.

197

ru

. , . , . . . . . 2000.

, ! ,. , . , , ,. , .. .

W ! ,. . ,,, , .

.

198

ru

. !

, ,,. .

. ..

,, ,, . W !

,, . . .

, .

, ! , !

. -(, ). ,, .

2. , .

! . .

199

ru

-. -!

. H! .

, . W !

.

W ! .

W ! , ..

W ! (X    . . 206).

W

i .

Y !.

W !. .

200

ru

.. 13 :

(11) .

, . 0/off,.

, , . .

. . .

A 1 2

EasyArmlift (.).

3 ( 0/off) . 0/off= M= , . 1-7,: 1= , 7=.

4 ( M 1-7). , ,. .

5 .

6 (*). .

Bosch. .

............. 197 .......................................... 197 .......................... 200 ................................ 200 ............................... 201 .......................................... 202 .......................................... 206 ................................................. 207 ...................................... 207 ...................... 208 ............ 210 ............................................. 210 .. 210

201

ru

7 (, , ) ( *)

8

9 ( *) .

10 11

12 13

14

15

16 -.

17 18 K 19 -

a Profi Supercut /

b /

c - d

-/-* 20 21 K * 22 23 24 *, , .

B ! ,/ . . EasyArmlift, .

: . .

.

/ -

1 7

15

17

13

2 7 *

3 6 37

35

202

ru

/ -

4

9 57

7 57

*/ .

W !

. ! / . . . .

,..

.

(.100) ; ( C).

: . ; .

! , .

.

..L

W ! . (12)! . . . ! . (13) , , .., , (14) (30% ), (15) , ,, ,; ,

203

ru

( D): . :

. - 2.

.

( 8).

, : : ; :

1.

, .

, 2.

(8).

( E):

2.

: , .

, .

: , ( E-4b).

.

1.

. .

.

.

. 2.

.

.

. . 2.

. . , ..

204

ru

..M

W ! He .- ! / .H . ! . . . F , (). . . Profi Supercut / , . :

Grob= Fein=

: ,, . : . / ,,, .

: 2= 4=

: , . : . - ,, . : . -/- . : ,- . G:

2.

: , .

3.

( G-5a).

, .

-- ( G-6a). , .

( G-6b).

205

ru

( ) .

, G-8, .

.

.

! . : . : , ,, .

.

.

.

. ( H).

.

..N

W / ! H ! / ! . .

W ! . J:

4.

.

( ) .

. = 1,25; =0,75.

.K .

.

J-8:

.

.

.

.

: .

206

ru

W ! .

, 70 C.

, .

, . (, ..) .

, :

, ,,.

, , .

.

. ,, ,-, ,, .

. XO ! . .

W !

..

. . .

.

. , !

W !

-. . . : ,, , (- ). .

W

! . , .

207

ru

: ,. 700 . 1(7). . : . ,.

W !

. K:

- .

.

W ! . : , . . . e e. cpaee

.

.

. ? ?

.

.

.

. 0/off, .

e . . . cpaee

. .

e . . , . cpaee

0/off.

1.

(1). .

. e , .. cpaee

.

.

. .

208

ru

, .

, L, MN. .

2 2-3.. 100 1 70 70 . ( ) 4-67 .

1 -1 .

:2x

6 500 1 2

500 ()

1000 1 250

,, .10 1.

5 . 120.

. 603.

. 21.

3 2.

:1-

3 135 135 255 10 150 150 .

, .

30 1.

35 5.

2. 3060 .

:2-

209

ru

125 ( )

100-125 1 1

250 .

1,36 3 .

250: 1, 563 .

:2x

500 1 80() 80 200250 251

1 1, 3-63 .

:2x

300 3 .1-2..(10-20)

353 .

: 1,5x

1000 2 2.. 600650 1, 673 .

1 1.. 1.. 1 1 . .

( ) 34 .

7, , .

, .

210

ru

, . , . . (E-Nr.) . , , , - . www.bosch-home.com

J - . - 2012/19/EU - - (waste electrical and electronic equipment WEEE). - - - . - , .

- , , .

.

, : www.bosch-home.ru. . Bosch - : www.bosch-home.ru/store. C , . .

1. _________________________________________________________

3. Bosch: , , , , , , , , , , , , , , - , , , , , , , .

4. , , . , - ( ) () .

, -: 81739 , - 34, (BSH Hausgerte GmbH, Carl-Wery-Str. 34, 81739 Mnchen, Germany). , , , - , 198515, -, . , . , .1 . , . , 119071, . , .15, (495) 737-2777, (495) 737-2798.

5. / .

6. . , . Bosch, . , , .

7. - 1 . , , , .

8. ! , , , - , . , , . ! , - . . , , , , , , (, ..), , , , , , 32144-2013. (, , , ). , ( ), . . - .

9. , . : www.bosch-home.ru. ( ) 2 . - 5 . , , , . FD , 1920, . 1920 .

* .

1-2 , ( / , ).

*: 8 (800) 200-29-61 : www.bosch-home.ru

2. _________________________________________________________

B34C065N1-1M00 03/2017

, , --. 34, 81739 ,

: , , ,

: Bosch

! . , , . - . , , - , 198515, -, . , . , .1 ., . , 119071, . , .15, (495) 737-2777, (495) 737-2798. , 198515, -, . , . , .1 ., . , 119071, . , .15, (495) 737-2777, (495) 737-2798 , , , 184- , - . , , , 198515, -, . , . , .1 ., . , 119071, . .15, (495) 737-2777. , , --. 34, 81739 , (Robert Bosch Hausgerte GmbH, Carl-Wery-Str. 34, 81739 Mnchen, Germany). (), , , --. 34, 81739 , (BSH Hausgerte GmbH, Carl-Wery-Str. 34, 81739 Mnchen, Germany). , , , , : , /

. . . 0 , 93%. , , - . - . - . , , , () , 18 . . ( E-Nr.), ( Type) Bosch, , () . :

E-Nr. < > / < > - 10 , ( ) Bosch. () E-Nr. /. , - . , , , , , - . , , , . , , , () , . , , - , , .

, - / , - ( ).

: 020/2011 004/2011 037/2016 . - , , - - - . , (800) 200-2961, http://www.bosch-home.ru.

, , --. 34, 81739 ,

: , , ,

: Bosch

! . , , . - . , , - , 198515, -, . , . , .1 ., . , 119071, . , .15, (495) 737-2777, (495) 737-2798. , 198515, -, . , . , .1 ., . , 119071, . , .15, (495) 737-2777, (495) 737-2798 , , , 184- , - . , , , 198515, -, . , . , .1 ., . , 119071, . .15, (495) 737-2777. , , --. 34, 81739 , (Robert Bosch Hausgerte GmbH, Carl-Wery-Str. 34, 81739 Mnchen, Germany). (), , , --. 34, 81739 , (BSH Hausgerte GmbH, Carl-Wery-Str. 34, 81739 Mnchen, Germany). , , , , : , /

. . . 0 , 93%. , , - . - . - . , , , () , 18 . . ( E-Nr.), ( Type) Bosch, , () . :

E-Nr. < > / < > - 10 , ( ) Bosch. () E-Nr. /. , - . , , , , , - . , , , . , , , () , . , , - , , .

, - / , - ( ).

: 020/2011 004/2011 037/2016 . - , , - - - . , (800) 200-2961, http://www.bosch-home.ru.

FB5859 / 2019

- *, **, ***,

. , MC812M865 CNCM30 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1250 MC812S814 CNCM30 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1250 MC812W501 CNCM30 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1000 MC812W620 CNCM30 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1100 MC812W872 CNCM30 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1250 MCM3100W CNCM12 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 800 MCM3110W CNCM12 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 800 MCM3200W CNCM12 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 800 MCM3201B CNCM12 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 800 MCM3401M CNCM12 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 800 MCM3501M CNCM12 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 800 MCM4000 CNCM20 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 700 MCM4100 CNCM20 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 800 MUM4406 CNUM5ST C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 500 MUM4426 CNUM5ST C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 500 MUM44R1 CNUM5ST C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 500 MUM4657 CNUM5ST C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 550 MUM4855 CNUM5ST C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 600 MUM4856 CNUM5ST C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 600

MUM4875EU CNUM5ST C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 600 MUM4880 CNUM5ST C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 600 MUM48SL CNUM5ST C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 600 MUM52120 CNUM50 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 700 MUM54D00 CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 900 MUM54G00 CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 900 MUM54I00 CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 900 MUM54P00 CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 900 MUM54Y00 CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 900 MUM58020 CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1000 MUM58225 CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1000 MUM58231 CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1000 MUM58243 CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1000 MUM5824C CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1000

MUM58252RU CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1000 MUM58420 CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1000 MUM58720 CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1000 MUM58920 CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1000 MUM58B00 CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1000 MUM58K20 CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1000 MUM58L20 CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1000 MUM59343 CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1000 MUM59M55 CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1000 MUM5XW10 CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1000 MUM5XW20 CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1000 MUM5XW40 CNUM51 C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 1000

MUM9A32S00 CNUM60A C-DE.46.B.77956 21.12.2016 20.12.2021 50/60 220-240 1200 MUM9Y35S12 CNUM60B C-DE.46.B.81253 28.07.2017 27.07.2022 50/60 220-240 1500 MUM9YX5S12 CNUM61B C-DE.46.B.81253 28.07.2017 27.07.2022 50/60 220-240 1500

MUMP1000 CNUM5ST C-DE.46.B.73522 12.02.2016 11.02.2021 50/60 220-240 600 ,

MFQ22100 CNHR30 C-DE.46.B.76049 17.08.2016 16.08.2021 50/60 220-240 375 MFQ2210D CNHR30 C-DE.46.B.76049 17.08.2016 16.08.2021 50/60 220-240 375 MFQ2210K CNHR30 C-DE.46.B.76049 17.08.2016 16.08.2021 50/60 220-240 375 MFQ2210P CNHR30 C-DE.46.B.76049 17.08.2016 16.08.2021 50/60 220-240 375 MFQ2210Y CNHR30 C-DE.46.B.76049 17.08.2016 16.08.2021 50/60 220-240 375 MFQ24200 CNHR30 C-DE.46.B.76049 17.08.2016 16.08.2021 50/60 220-240 400 MFQ2420B CNHR30 C-DE.46.B.76049 17.08.2016 16.08.2021 50/60 220-240 400 MFQ2520B CNHR30C C-DE.46.B.88695 22.10.2018 21.10.2023 50/60 220-240 500 MFQ2600G CNHR30 C-DE.46.B.76049 17.08.2016 16.08.2021 50/60 220-240 375 MFQ2600W CNHR30 C-DE.46.B.76049 17.08.2016 16.08.2021 50/60 220-240 375 MFQ3010 CNHR19 C-DE.46.B.73034 30.12.2015 29.12.2020 50/60 220-240 300 MFQ3030 CNHR19 C-DE.46.B.73034 30.12.2015 29.12.2020 50/60 220-240 350 MFQ3555 CNHR18 C-DE.46.B.73034 30.12.2015 29.12.2020 50/60 220-240 350

MFQ36300Y CNHR27 C-DE.46.B.73034 30.12.2015 29.12.2020 50/60 220-240 400 MFQ36440 CNHR27 C-DE.46.B.73034 30.12.2015 29.12.2020 50/60 220-240 450 MFQ36460 CNHR27 C-DE.46.B.73034 30.12.2015 29.12.2020 50/60 220-240 450 MFQ36470 CNHR27 C-DE.46.B.73034 30.12.2015 29.12.2020 50/60 220-240 450 MFQ36480 CNHR27 C-DE.46.B.73034 30.12.2015 29.12.2020 50/60 220-240 450 MFQ4020 CNHR22 C-DE.46.B.73034 30.12.2015 29.12.2020 50/60 220-240 450

MFQ4030K CNHR22 C-DE.46.B.73034 30.12.2015 29.12.2020 50/60 220-240 500 MFQ4070 CNHR22 C-DE.46.B.73034 30.12.2015 29.12.2020 50/60 220-240 500 MFQ4080 CNHR22 C-DE.46.B.73034 30.12.2015 29.12.2020 50/60 220-240 500

MFQP1000 CNHR19 C-DE.46.B.73034 30.12.2015 29.12.2020 50/60 220-240 300 MMR08A1 CNCM13ST1 C-DE.46.B.73343 29.01.2016 28.01.2021 50/60 220-240 400 MMR15A1 CNCM13ST2 C-DE.46.B.73343 29.01.2016 28.01.2021 50/60 220-240 550 MMRP1000 CNCM13ST1 C-DE.46.B.73343 29.01.2016 28.01.2021 50/60 220-240 400

* ** ***

214

ar 12

361

.3 2:

300 3 (1020)12

53

.3 1.5:

1000 2 2 600650

671 .3

1 1 1 1 1

.

. ()

.43

7

.

. .

. . .

(ENr. ) .

. www.bosch-home.com

J .

/19/2012

(waste electrical and electronic equipment WEEE).

.

.

. .

.

.

215

11 ar

() 64

.7 1

1

. 2:

6 500 1 2

()500 1000 1 250 :

10 .1

1205 .

60 .3

.12

3 .2

1:

3 135 ()135 255 10 150

150 . . .130 .535 .2 3060

. 2:

125 ()

100125 1 1 250

361 .3

:250

561 .3

2:

500 1 ()80 80 200250 125 1

216

ar 10

W !

.

:

.

.

.

.

.

.

.

.

.

. .

P .

.

. .

. .

. .

.

.P

.1 .(1) .

.

.

.

.

. . .

.

.NM L .

2 23 100 1 70 70

217

9 ar

:

.

.

.

.

.

. :O !

. .

W !

.

. .

.

.

.

.

!

W !

.

.

. :

) .(

.

W !

.

. :

. 700 . .(7)1

. :

.

.

W !

.

:K

.

.

218

ar 8

:

. :

.

.

.

.

.

.(H ) .

N.

W ! /

! /

! ..

W !

. :J

.4

.

)

( .

. 1.25=

0.75=

..

. :J-8

.

.

.

.

. :

. W !

.

.70

.

. ()

.

219

7 ar

:F

.()

. .

/

.

: = =

: .

.: /

. : =2 =4

: .

.:

.

: .

/

. :

.

:G

.2 :

.

.3

.(G-5a )

.

.(G-6a )

.

.(G-6b ) ()

.

G-8

.

.

. !

.

220

ar 6

:

.: :

.1

.

.2

(SW 8) .

:(E )

.2

:

.

.

.(E-4b ) .

.1

.

.

.

.

.

.2

.

. . .

.2

. . .

.

M.

W !

.

! /

. .

!

.

.

.

221

5 ar

W !

. !

/ . .

. .

.

.

100) :( .(C )

.

.

!

. .

L.

W !

.

(12) !

-

.

.

. !

.

(13)

(14)

30%) (

(15)

:(D )

.

: .

.2

.

(SW 8)

.

222

ar 4

8 9 (* )

.

10

11 12

13 14 15 16

.

17 18 19

a /

b / c d */

20 21

* 22 23 24

*

.

:B

! /

.

.

Easy Armlift .

:

..

.

/

17

7 115

13

* 7 2

37 6 3

35

57 9 4

57 7

/* .

223

3 ar

.

:31

(11)

.

. off/0

.

.

.

. !

:A

1 2

Easy Armlift .()

3 (P)

. =P

=M

. 7-1 =1

.=7 4

) .(1-7M

.

5

.

6

.(*)

. 7

) (*) (

.Bosch

.

ar1 ..................... ar1 ........................... ar3 ............................ ar3 ......................................... ar4 ................................... ar5 .................................... ar9 ........................ ar9 ............................... ar10 ............... ar10 ........................ ar12 ............................... ar12 ............................. ar12 ..................................

224

ar 2

.().

. .

.

.!

. .

! . .! . W !

. W !

. W !

. .

W ! Y)

.(ar9 W

. i .! Y

.! . W

225

1 ar

.

. .

. .

..

.2000

! . .

. . ..

W !

. .

. . .

! .

. .

..

. W !

. .

. .

! !

DE Deutschland, Germany BSH Hausgerte Service GmbH Zentralwerkstatt fr kleine Hausgerte Trautskirchener Strasse 6-8 90431 Nrnberg Online Auftragsstatus, Filterbeutel- Konfigurator und viele weitere Infos unter: www.bosch-home.com Reparaturservice, Ersatzteile & Zubehr, Produkt-Informationen: Tel.: 0911 70 440 040 mailto:Kleingeraete@bshg.com AE United Arab Emirates,

BSH Home Appliances FZE Round About 13, Plot Nr MO-0532A Jebel Ali Free Zone - Dubai Tel.: 04 881 44 01* mailto:service.uae@bshg.com www.bosch-home.com/ae * Sun-Thu 8am to 5pm (exclude public holidays)

AL Republika e Shqiperise, Albania Elektro-Service sh.p.k Rruga Kasem Shima, Kodi postar-1050 Prane Ures Mezezit 1023 Tirane Tel.: 4 227 8130; -131 mailto:info@elektro-servis.com EXPERT Service Rruga e Kavajes, Kulla B Nr 223/1 Kati I 1023 Tirane Tel.: 4 480 6061; 4 227 4961 Cel: +355 069 60 45555 mailto:info@expert-servis.al AM Armenia, ZIG ZAG LLC Charenci str. 25 Yerevan 375025 Tel.: 010 55 60 10 mailto:service@zigzag.am www.zigzag.am AT sterreich, Austria BSH Hausgerte Gesellschaft mbH Werkskundendienst fr Hausgerte Quellenstrasse 2a 1100 Wien Online Reparaturannahme, Ersatzteile und Zubehr und viele weitere Infos unter: www.bosch-home.at Reparaturservice, Ersatzteile & Zubehr, Produktinformationen Tel.: 0810 550 511* mailto:vie-stoerungsannahme@bshg.com * Wir sind an 365 Tagen von 07:00 bis 22:00 Uhr fr Sie erreichbar.

AU Australia BSH Home Appliances Pty. Ltd. Gate 1, 1555 Centre Road Clayton, Victoria 3168 Tel.: 1300 369 744* mailto:customersupport.au@bshg.com www.bosch-home.com.au * Mon-Fri 24 hours

AZ AzrbaycanRespublikas, Azerbaijan

Baku Service Company MMC Azadliq Pr. 116 Baku Tel.: 12 530 90 35 mailto:nfo@bakuservice.az www.ser-cen.az Yurd Service MMC 50, Bakikhanov Str. Baku, AZ1007 Tel.: 12 480 33 01 mailto:info-service@yurd.az www.yurd.az Optimal Elektronika MMC Hasanoghlu 7B Baku, AZ1072 Tel.: 12 954 mailto:STMS@optimal.az www.optimal.az BA Bosna i Hercegovina,

Bosnia-Herzegovina HIGH d.o.o. Gradaaka 29b 71000 Sarajevo Tel./Fax: 033 21 35 13 mailto:centralniservis@yahoo.com BE Belgique, Belgi, Belgium BSH Home Appliances S.A. - N.V. Rue Picard 7, box 400, Picardstraat 7, box 400 1000 Bruxelles Brussel Tel.: 02 475 70 01 mailto:bru-repairs@bshg.com www.bosch-home.be BG Bulgaria BSH Domakinski Uredi Bulgaria EOOD Business center FPI, floor 5, Cherni vrah Blvd. 51B 1407 Sofia Tel.: 0700 208 17 mailto:informacia.servis-bg@bshg.com www.bosch-home.bg BH Bahrain, Khalaifat Est. BLD 898, R 533, TASHAN 405 Manama Tel.: 01 740 05 53* mailto:service@khalaifat.com * Sat-Thu 7am to 5pm (exclude public holidays)

BY Belarus, OOO .: 495 737 2961 mailto:mok-kdhl@bshg.com CA Canada BSH Home Appliances Ltd. Tel.: 800 944 2904 mailto:bosch-canada-questions@bshg.com www.bosch-home.com/us CH Schweiz, Suisse,

Svizzera, Switzerland BSH Hausgerte AG Bosch Hausgerte Service Fahrweidstrasse 80 8954 Geroldswil Reparaturservice, Ersatzteile & Zubehr, Produktinformationen Tel.: 0848 888 200 mailto:ch-service@bshg.com mailto:ch-spareparts@bshg.com www.bosch-home.ch

CN China, BSH Home Appliances Service Jiangsu Co. Ltd. 19F, Jinling Asia Pacific Tower, No.2 Hanzhong Road, Gulou District, 210005 Nanjing, Jiangsu Province Service Tel.: 400 8855 888* mailto:careline.china@bshg.com www.bosch-home.cn * phone rate depends on the network used

CY Cyprus, BSH Ikiakes Syskeves-Service 39, Arh. Makaariou III Str. 2407 Egomi/Nikosia (Lefkosia) Tel.: 777 78 007 mailto:EGO-CYCustomerService@bshg.com CYN Turkish Rep. Of North Cyprus Argas Limited Company 37 Osman Paa Cad. K. iltlik Lefkoa Tel.: 0228 40 70 mailto:argas.teknik@yar-group.com Semson Ticaret Sti. Ltd. Bedrettin Demirel Cad. no 17 Girne Tel.: 0816 04 94 mailto:m.defterali@ercantangroup.com CZ eskRepublika,CzechRepublic Vce informac (nap. zrun podmnky, prodlouen zruka aj.), naleznete na webovch strnkch www.bosch-home.com/cz/ nebo ns kontaktujte na +420 251 095 511 BSH domc spotebie s.r.o. Radlick 350/107c 158 00 Praha 5 Pjem oprav Tel.: +420 251 095 043 mailto:opravy@bshg.com DK Danmark, Denmark BSH Hvidevarer A/S Telegrafvej 4 2750 Ballerup Tel.: 44 89 80 18 mailto:BSH-Service.dk@bshg.com www.bosch-home.dk EE Eesti, Estonia Renerki Kaubanduse O Tammsaare tee 134B (Euronicsi kaupluses) 12918 Tallinn Tel.: 0651 2222 mailto:klienditeenindus@renerk.ee www.renerk.ee Eliser O Mustame tee 24 10621 Tallinn Tel.: 0665 0090 mailto:hooldus@eliser.ee www.kodumasinate-remont.ee ES Espaa, Spain BSH Electrodomsticos Espaa S.A. Servicio Oficial del Fabricante Parque Empresarial PLAZA, C/ Manfredonia, 6 50197 Zaragoza Tel.: 976 305 713 mailto:CAU-Bosch@bshg.com www.bosch-home.es FI Suomi, Finland BSH Kodinkoneet Oy Itlahdenkatu 18 A, PL 123 00201 Helsinki Tel.: 0207 510 705* mailto:Bosch-Service-FI@bshg.com www.bosch-home.fi * Soittajahinta on kiintest verkosta ja matkapu- helimesta 8,35 snt/puh + 16,69 snt/min.

Kundendienst Customer Service

10/20

CP-Normal_Bosch_10_2020.indd 1 09.10.20 12:16

0,40 / min

0,40 / min

FR France BSH Electromnager S.A.S. Service Aprs-Vente 26 ave Michelet CS 90045 93582 SAINT-OUEN cedex Service interventions domicile: 01 40 10 11 00 Service Consommateurs: 0 892 698 010 Service Pices Dtaches et Accessoires: 0 892 698 009 mailto:serviceconsommateur.fr@ bosch-home.com www.bosch-home.com/fr GB Great Britain BSH Home Appliances Ltd. Grand Union House Old Wolverton Road Wolverton Milton Keynes MK12 5PT To arrange an engineer visit, to order spare parts and accessories or for product advice please visit www.bosch-home.co.uk or call Tel.: 0344 892 8979* * Calls are charged at the basic rate, please check with your telephone service provider for exact charges.

GE Georgia, Elit Service Ltd. Vake-Saburtalo district, ntersection of Al. Kazbegi ave. and Kavtaradze Str. 0186 Kavtaradze str. 1 Tbilisi Tel.: 32 300 020 mailto:info@es.ge GR Greece, BSH Ikiakes Siskeves A.B.E. Central Branch Service 17 km E.O. Athinon-Lamias & Potamou 20 14564 Kifisia T: 210 4277 500; -701 mailto:nkf-CustomerService@bshg.com www.bosch-home.gr HK Hong Kong, BSH Home Appliances Limited 3882307 Unit 07, 23/F, CDW Building, 388 Castle Peak Road, Tsuen Wan, New Territories, Hong Kong Tel.: 2626 9655 (HK) Toll free 0800 863 (Macao) mailto:bosch.hk.service@bshg.com www.bosch-home.com.hk HR Hrvatska, Croatia BSH kuanski ureaji d.o.o. Ulica grada Vukovara 269F 10000 Zagreb Tel.: 01 5520 888 mailto:informacije.servis-hr@bshg.com www.bosch-home.com/hr HU Magyarorszg,Hungary BSH Hztartsi Kszlk Kereskedelm Kft. rpd fejedelem tja 26-28 1023 Budapest Call Center: +06 80 200 201 mailto:BSH-szerviz@bshg.com www.bosch-home.com/hu

IE Republic of Ireland BSH Home Appliances Ltd. M50 Business Park Ballymount Road Upper Walkinstown Dublin 12 To arrange an engineer visit, to order spare parts and accessories or for product advice please call Tel.: 01450 2655* www.bosch-home.ie * Calls are charged at the basic rate, please check with your telephone service provider for exact charges.

IL Israel C/S/B/ Home Appliance Ltd. 1, Hamasger St. North Industrial Park Lod, 7129801 Tel.: 08 9777 222 mailto:csb-serv@csb-ltd.co.il www.bosch-home.co.il IN India,Bhrat, BSH Household Appliances Mfg. Pvt. Ltd. Arena House, Main Bldg, 2nd Floor, Plot No. 103, Road No. 12, MIDC, Andheri East Mumbai 400 093 Toll Free 1800 266 1880* www.bosch-home.com/in * Mon-Sat 8am to 8pm (exclude public holidays)

IS Iceland Smith & Norland hf. Noatuni 4 105 Reykjavik Tel.: 0520 3000 www.sminor.is IT Italia, Italy BSH Elettrodomestici S.p.A. Via. M. Nizzoli 1 20147 Milano (MI) Tel.: 02 412 678 100 mailto:info.it@bosch-home.com www.bosch-home.com/it JO Jordan, Diab Qawasmi & Sons Co. Khaled Ben Al-Waleed Street, Jabal Al Hussein (11121), P.O. Box 212292 Amman Tel.: 06 465 8505, -2650 Tel.: 79 110 3430 mailto:boschjo@yahoo.com KG Kyrgyzstan, OcOO Alfa Systems Jibek Jolu str. 40 Bishkek Tel.: 0702 98 53 53 mailto:alfas-service@mail.ru KR Republic Korea,

Daehan Minguk, Empel Co. Ltd. 1201 ACE High Tech City 1 Building 775 Gyeongin-ro Youngdeungpo-gu Seoul 07299 South Korea Tel.: 1899 4636 mailto:hsshim@empel.co.kr

KZ Kazakhstan, BSH Home Appliances LLP Dostyk 117/6, Business Center Khan Tengri Almaty Hotline: 5454* mailto:ALA-Service@bshg.com * Toll free from mobile only

LB Lebanon, Teheni, Hana & Co. Boulevard Dora 4043 Beyrouth P.O. Box 90449 Jdeideh, 1202 2040 Tel.: 01 255 211 mailto:Info@tehini-hana.com LT Lietuva, Lithuania UAB AG Service R. Kalantos g. 32 52494 Kaunas Tel.: +370 (8) 700 556 55 mailto:servisas@agservice.lt www.agservice.lt Baltic Continent Ltd. Lukio g. 23 09132 Vilnius Tel.: +370 (8) 700 555 95 mailto:info@balticcontinent.lt www.balticcontinent.lt UAB Emtoservis Savanori pr. 1 (Centrin bstin) 03116 Vilnius Tel.: +370 (8) 700 447 24 mailto: svc@emtoservis.lt www.emtoservis.lt LU Luxembourg BSH lectromnagers S.A. 13-15, ZI Breedeweues 1259 Senningerberg Tel.: 26 349 811 Reparaturen: lux-repair@bshg.com Ersatzteile: lux-spare@bshg.com www.bosch-home.com/lu LV Latvija, Latvia SIA General Serviss Buu iela 70c 1067 Riga Tel.: +371 6742 5232 mailto:info@serviscentrs.lv www.serviscentrs.lv SIA Koroso Vestienas iela 2 1004 Riga Tel.: +371 2200 4203 mailto:servis@koroso.lv www.koroso.lv EMTA Serviss SIA NEU Katlakalna 1 1073 Riga Tel.: +371 6602 0338 mailto:info@emta.lv www.emta.lv Sia Elektronika-Serviss Tadaiu iela 4 1004 Riga Tel.: +371 6771 7060 mailto:serviss@elektronika.lv www.elektronika.lv MD Moldova S.R.L. Rialto-Studio , 1, 3, 2069 .: (37322) 84 00 50, 84 00 54 mailto:service@rialto.md ME Crna Gora, Montenegro Elektronika komerc Oktobarske revolucije 129 81000 Podgorica Tel./Fax: 020 674 631 Mobil: 069 324 812 mailto:ekobosch.servis@t-com.me

10/20

CP-Normal_Bosch_10_2020.indd 2 09.10.20 12:16

MK Macedonia,Makeo GORENEC Jane Sandanski 69 lok. 3 1000 Skopje Tel.: 02 2454 600 Mobil: 070 233 689 mailto:gorenec@yahoo.com MT Malta Oxford House Ltd. Notabile Road Mriehel BKR 14 Tel.: 021 442 334 www.oxfordhouse.com.mt MV Raajjeyge Jumhooriyyaa,

Maledives Lintel Investments and Management Services Pvt. Ltd. Ma. Maadheli, Majeedhee Magu Mal Tel.: 03 010 200 mailto:mohamed.zuhuree@lintel.com.mv www.lintel.com.mv NL Nederlande, Netherlands BSH Huishoudapparaten B.V. Taurusavenue 36 2132 LS Hoofddorp Storingsmelding/Onderdelenverkoop: Tel.: 088 424 4010 mailto:bosch-contactcenter@bshg.com mailto:bosch-onderdelen@bshg.com www.bosch-home.nl NO Norge, Norway BSH Husholdningsapparater A/S Grensesvingen 9 0661 Oslo Tel.: 22 66 05 54 mailto:Bosch-Service-NO@bshg.com www.bosch-home.no NZ New Zealand BSH Home Appliances Ltd. Level 3, Air NZ Building, Smales Farm Business Park 74 Taharoto Road, Takapuna Auckland 0622 Tel.: 0800 245 700* mailto:aftersales.nz@bshg.com www.bosch-home.co.nz * Mon-Fri 8.30am to 5pm (exclude public holidays)

PK Pakistan, MEGA Home Appliances Plaza 46-A, Commercial Sector XX, Phase 3, DHA Lahore Tel.: 0800-BOSCH (26724)* Tel.: 42 371 32 682-5 Ext: 8005* mailto:customer.care@megahome.pk www.megahome.pk * Mon-Sat 9am to 6pm (exclude public holidays)

PL Polska, Poland BSH Sprzt Gospodarstwa Domowego sp. z o.o. Al. Jerozolimskie 183 02-222 Warszawa Tel.: +48 42 271 5555 mailto:Serwis.Fabryczny@bshg.com www.bosch-home.pl PT Portugal BSHP Electrodomsticos, Sociedade Unipessoal, Lda. Rua Alto do Montijo, n 15 2790-012 Carnaxide Tel.: 214 250 730 mailto:bosch.electrodomesticos.pt@bshg.com www.bosch-home.pt

RO Romnia, Romania BSH Electrocasnice srl. Sos. Bucuresti-Ploiesti, nr. 19-21, sect.1 13682 Bucuresti Tel.: 021 203 9748 mailto:service.romania@bshg.com www.bosch-home.ro RU Russia, , 15 119071 .: 8 (800) 200 29 61 mailto:hotlineru@bshg.com www.bosch-home.com SA Kingdom Saudi Arabia,

Abdul Latif Jameel Electronics and Airconditioning Co. Ltd. BOSCH Service centre, Kilo 5 Old Makkah Road (Next to Toyota), Jamiah Dist., P.O. Box 7997 Jeddah 21472 Tel.: 800 127 9999* mailto:ALJECC8@ALJ.COM www.aljelectronics.com.sa * Sat-Thu 8am to 11pm (exclude public holidays)

SE Sverige, Sweden BSH Home Appliances AB Landsvgen 32 169 29 Solna Tel.: 0771 197 000 mailto:Bosch-Service-SE@bshg.com www.bosch-home.se SG Singapore, BSH Home Appliances Pte. Ltd. 38C Jalan Pemimpin, #01-01 Singapore 577180 Tel.: 6751 5000* mailto:bshsgp.service@bshg.com www.bosch-home.com.sg * Mon-Fri 9am to 6pm, Sat 9am to 1pm (exclude public holidays)

SI Slovenija, Slovenia BSH Hini aparati d.o.o. Litostrojska 48 1000 Ljubljana Tel.: 01 5830 700 mailto:informacije.servis-slo@bshg.com www.bosch-home.com/si SK Slovensko, Slovakia Viac informci (napr. zrun podmienky, preden zruka a i.) njdete nawebovch rnkach www.bosch-home.com/sk/ alebo ns kontaktujte na +420 251 095 511 BSH domc spotebie s.r.o. organizan zloka Bratislava Trnavsk cesta 50 821 02 Bratislava Prjem oprv Tel.: +421 238 106 115 mailto:opravy@bshg.com TH Thailand, BSH Home Appliances Limited Ital Thai Tower, 2034/31-39, 1st floor, New Petchburi Road Bangkapi, Huay Kwang Bangkok, 10310 Tel.: 02 495 2424* www.bosch-home.com/th * Mon-Sat 8am to 6pm (exclude public holidays)

TJ Tadschikistan,

P.E. Suhrob Muhitdinov Shamsi street no: 67/ Dushanbe Tel.: 091 867 80 43 mailto:sino2003@list.ru Vostok Co. Ltd. Yakkacinarskaya street No: 144/4 Dushanbe Tel.: 44 600 78 72 mailto:Lola.Mirzoeva@vostok.tj www.volna.tj TM Trkmenistan, Turkmenistan Bayram Anna Yuryewna Stariya marka, Atabeyeva str. Spectrum maaza Ashgabat Tel.: 012 26 94 16 mailto:steptm@mail.ru TR Trkiye, Turkey BSH Ev Aletleri Sanayi ve Ticaret A.S. Fatih Sultan Mehmet Mahallesi Balkan Caddesi No: 51 34771 mraniye, Istanbul Tel.: 0 216 444 6333* mailto:careline.turkey@bshg.com www.bosch-home.com/tr * ar merkezini sabit hatlardan aramann bedeli ehir ii cretlendirme, Cep telefonlarndan ise kullanlan tarifeye gore deikenlik gstermektedir

TW Taiwan, BSH Home Appliances Private Limited 8011 11F., No.80, Zhouzi St., Neihu Dist. Taipei City 11493 Tel.: 0800 368 888 mailto:bshtzn-service@bshg.com www.bosch-home.com.tw UA Ukraine, TOB .: 0 800 300 152* mailto:BSH-serviceua@bshg.com www.bosch-home.com.ua * - - 9.00 18.00

UZ Ozbekiston Respublikasi, Republic of Uzbekistan

Elektronik Magnat Beruni street No: 5/6 Tashkent Tel.: 712 156 333 mailto:magnat.service.uzb@gmail.com XK Kosovo Service-General SH.P.K. rr.Magjistralja Ferizaj Prishtine 70000 Ferizaj Tel.: 00381 (0) 290 330 723 mailto:servicegeneral527@gmail.com XS Srbija, Serbia BSH Kuni aparati d.o.o. Milutina Milankovia br. 9 11070 Novi Beograd Tel.: 011 353 70 08 mailto:informacije.servis-sr@bshg.com www.bosch-home.rs ZA South Africa BSH Home Appliances (Pty) Ltd. 96 Fifteenth Road, Randjespark 1685 Midrand - Johannesburg Tel.: 086 002 6724 mailto:bsh@iopen.co.za mailto:applianceserviceza@bshg.com www.bosch-home.com/za

10/20

CP-Normal_Bosch_10_2020.indd 3 09.10.20 12:16

DE Garantiebedingungen BSH Hausgerte GmbH, Deutschland

Stand: Januar 2020

Die nachstehenden Bedingungen, die Voraussetzungen und Umfang unserer Garantieleistung beschreiben, lassen die Gewhrleistungsverpflichtungen des Verkufers aus dem Kaufvertrag mit dem Endabnehmer unberhrt.

Fr dieses Gert leisten wir Garantie gem den nachstehenden Bedingungen:

1. Wir beheben unentgeltlich nach Magabe der folgenden Bedingungen (Nr.2 6) Mngel am Gert, die nach- weislich auf einem Material- und/oder Herstellungsfehler beruhen, wenn sie uns unverzglich nach Feststellung und innerhalb von 24 Monaten nach Lieferung an den Erstendabnehmer gemeldet werden. Zeigt sich der Mangel innerhalb von 6 Monaten ab Lieferung, wird vermutet, dass es sich um einen Material- oder Herstellungs- fehler handelt.

2. Die Garantie erstreckt sich nicht auf zerbrechliche Teile wie z.B. Glas oder Kunststoff bzw. Glhlampen. Eine Garantiepflicht wird nicht ausgelst durch geringfgige Abweichungen von der Soll-Beschaffenheit, die fr Wert und Gebrauchstauglichkeit des Gertes unerheblich sind, oder durch Schden aus chemischen und elektrochemischen Einwirkungen von Wasser, sowie allgemein aus anomalen Umweltbedingungen oder sach- fremden Betriebsbedingungen oder wenn das Gert sonst mit ungeeigneten Stoffen in Berhrung gekommen ist. Ebenso kann keine Garantie bernommen werden, wenn die Mngel am Gert auf Transportschden, die nicht von uns zu vertreten sind, nicht fachgerechte Installation und Montage, Fehlgebrauch, eine nicht haushaltsbliche Nutzung, mangelnde Pflege oder Nichtbeachtung von Bedienungs- oder Montagehinweisen zurckzufhren sind. Der Garantieanspruch erlischt, wenn Reparaturen oder Eingriffe von Personen vorgenommen werden, die hierzu von uns nicht ermchtigt sind, oder wenn unsere Gerte mit Ersatzteilen, Ergnzungs- oder Zubehrteilen versehen werden, die keine Originalteile sind und dadurch ein Defekt verursacht wird.

3. Die Garantieleistung erfolgt in der Weise, dass mangelhafte Teile nach unserer Wahl unentgeltlich instand- gesetzt oder durch einwandfreie Teile ersetzt werden. Gerte, die zumutbar (z.B. im PKW) transportiert werden knnen, und fr die unter Bezugnahme auf diese Garantie eine Garantieleistung beansprucht wird, sind unserer nchstgelegenen Kundendienststelle oder unserem Vertragskundendienst zu bergeben oder zuzusenden. Instandsetzungen am Aufstellungsort knnen nur fr stationr betriebene (feststehende) Gerte verlangt werden. Es ist jeweils der Kaufbeleg mit Lieferdatum oder wenigstens mit dem Kaufdatum vorzulegen. Ersetzte Teile gehen in unser Eigentum ber.

4. Sofern die Nachbesserung von uns abgelehnt wird oder fehlschlgt, wird innerhalb der oben genannten Garantiezeit auf Wunsch des Endabnehmers kostenfrei gleichwertiger Ersatz aus dem lokalen Gerteportfolio geliefert.

5. Garantieleistungen bewirken weder eine Verlngerung der Garantiefrist, noch setzen sie eine neue Garantiefrist in Lauf. Die Garantiefrist fr eingebaute Ersatzteile endet mit der Garantiefrist fr das ganze Gert.

6. Weitergehende oder andere Ansprche, insbesondere solche auf Ersatz auerhalb des Gertes entstandener Schden sind soweit eine Haftung nicht zwingend gesetzlich angeordnet ist ausgeschlossen.

Diese Garantiebedingungen gelten fr Gerte, die in Deutschland gekauft und betrieben werden. Werden Gerte in ein anderes Land der EU/der EFTA verbracht (Zielland) und dort betrieben, die die tech- nischen Voraussetzungen (z.B. Spannung, Frequenz, Gasarten, etc.) fr das Zielland aufweisen und die fr die jeweiligen Umweltbedingungen geeignet sind, gelten die Garantiebedingungen des Ziellandes, soweit wir in diesem Land ein Kundendienstnetz haben. Diese knnen Sie bei der Landesvertretung des Ziellandes anfordern. Bei Verbringung in Lnder auerhalb der EU/der EFTA erlischt die Garantie.

Beachten Sie unser weiteres Kundendienstangebot: Auch nach Ablauf der Garantie stehen Ihnen unser Werkskundendienst und unsere Servicepartner zur Verfgung.

Robert Bosch Hausgerte GmbH Carl-Wery-Strae 34 81739 Mnchen, GERMANY

Bosch-Infoteam (Mo-Fr: 8.00-18.00 Uhr erreichbar) Fr Produktinformationen sowie Anwendungs- und Bedienungsfragen zu kleinen Hausgerten:

Tel.: 0911 70 440 040 oder unter

bosch-infoteam@bshg.com

Nur fr Deutschland gltig!

03/20

Gebrauchsanweisungen_Garantieseite_Bosch_2020.indd 1 16.03.20 09:49

6

6 6

Robert Bosch Hausgerte GmbH Carl-Wery-Strae 34 81739 Mnchen GERMANY www.bosch-home.com

Register your new device on MyBosch now and profit directly from:

Expert tips & tricks for your appliance Warranty extension options Discounts for accessories & spare-parts Digital manual and all appliance data at hand Easy access to Bosch Home Appliances Service

Free and easy registration also on mobile phones: www.bosch-home.com/welcome

Expert advice for your Bosch home appliances, need help with problems or a repair from Bosch experts. Find out everything about the many ways Bosch can support you: www.bosch-home.com/service Contact data of all countries are listed in t

Manualsnet FAQs

If you want to find out how the Universal Bosch works, you can view and download the Bosch Universal MUM59N26CB Kitchen Machine User Manual on the Manualsnet website.

Yes, we have the User Manual for Bosch Universal as well as other Bosch manuals. All you need to do is to use our search bar and find the user manual that you are looking for.

The User Manual should include all the details that are needed to use a Bosch Universal. Full manuals and user guide PDFs can be downloaded from Manualsnet.com.

The best way to navigate the Bosch Universal MUM59N26CB Kitchen Machine User Manual is by checking the Table of Contents at the top of the page where available. This allows you to navigate a manual by jumping to the section you are looking for.

This Bosch Universal MUM59N26CB Kitchen Machine User Manual consists of sections like Table of Contents, to name a few. For easier navigation, use the Table of Contents in the upper left corner.

You can download Bosch Universal MUM59N26CB Kitchen Machine User Manual free of charge simply by clicking the “download” button in the upper right corner of any manuals page. This feature allows you to download any manual in a couple of seconds and is generally in PDF format. You can also save a manual for later by adding it to your saved documents in the user profile.

To be able to print Bosch Universal MUM59N26CB Kitchen Machine User Manual, simply download the document to your computer. Once downloaded, open the PDF file and print the Bosch Universal MUM59N26CB Kitchen Machine User Manual as you would any other document. This can usually be achieved by clicking on “File” and then “Print” from the menu bar.