ASUS GX810 Mouse User Manual PDF

1 of 279
1 of 279

Summary of Content for ASUS GX810 Mouse User Manual PDF

User Manual

ASUS GX810 ROG Gaming Mouse

15G06S00XXXX

English

Contents

English ....................................................................................... 1-22

.................................................................................... 23-38

.................................................................................... 39-54

etina ..................................................................................... 55-70

Franais ................................................................................... 71-86

Deutsch..................................................................................87-102

Magyar.................................................................................103-118

Italiano ................................................................................119-136

Polski ...................................................................................137-152

Portugus ............................................................................153-168

................................................................................169-184

Romn ...............................................................................185-200

Slovensky ............................................................................201-216

Slovenina .........................................................................217-232

Espaol ................................................................................233-248

Trke ..................................................................................249-264

..........................................................................265-279

En gl

is h

Q6405

First Edition (V1)

February 2011

Copyright 2011 ASUSTeK Computer Inc. All Rights Reserved.

No part of this manual, including the products and software described in it, may be reproduced, transmitted, transcribed, stored in a retrieval system, or translated into any language in any form or by any means, except documentation kept by the purchaser for backup purposes, without the express written permission of ASUSTeK Computer Inc. (ASUS).

Product warranty or service will not be extended if: (1) the product is repaired, modified or altered, unless such repair, modification of alteration is authorized in writing by ASUS; or (2) the serial number of the product is defaced or missing.

ASUS PROVIDES THIS MANUAL AS IS WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE IMPLIED WARRANTIES OR CONDITIONS OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. IN NO EVENT SHALL ASUS, ITS DIRECTORS, OFFICERS, EMPLOYEES OR AGENTS BE LIABLE FOR ANY INDIRECT, SPECIAL, INCIDENTAL, OR CONSEQUENTIAL DAMAGES (INCLUDING DAMAGES FOR LOSS OF PROFITS, LOSS OF BUSINESS, LOSS OF USE OR DATA, INTERRUPTION OF BUSINESS AND THE LIKE), EVEN IF ASUS HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES ARISING FROM ANY DEFECT OR ERROR IN THIS MANUAL OR PRODUCT.

SPECIFICATIONS AND INFORMATION CONTAINED IN THIS MANUAL ARE FURNISHED FOR INFORMATIONAL USE ONLY, AND ARE SUBJECT TO CHANGE AT ANY TIME WITHOUT NOTICE, AND SHOULD NOT BE CONSTRUED AS A COMMITMENT BY ASUS. ASUS ASSUMES NO RESPONSIBILITY OR LIABILITY FOR ANY ERRORS OR INACCURACIES THAT MAY APPEAR IN THIS MANUAL, INCLUDING THE PRODUCTS AND SOFTWARE DESCRIBED IN IT.

Products and corporate names appearing in this manual may or may not be registered trademarks or copyrights of their respective companies, and are used only for identification or explanation and to the owners benefit, without intent to infringe.

English

Contact Information

ASUSTeK COMPUTER INC. Address 15 Li-Te Road, Peitou, Taipei, Taiwan 11259 Telephone +886-2-2894-3447 Fax +886-2-2890-7798 E-mail info@asus.com.tw Web site www.asus.com.tw

Technical Support Telephone +86-21-38429911 Online support support.asus.com

ASUS COMPUTER INTERNATIONAL (America) Address 800 Corporate Way, Fremont, CA 94539, USA Telephone +1-510-739-3777 Fax +1-510-608-4555 Web site usa.asus.com

Technical Support Telephone +1-812-282-2787 Support fax +1-812-284-0883 Online support support.asus.com

ASUS COMPUTER GmbH (Germany and Austria) Address Harkort Str. 21-23, D-40880 Ratingen, Germany Fax +49-2102-959911 Web site www.asus.de Online contact www.asus.de/sales

Technical Support Telephone (Component) +49-1805-010923* Telephone (System/Notebook/Eee/LCD) +49-1805-010920* Support Fax +49-2102-9599-11 Online support support.asus.com

* EUR 0.14/minute from a German fixed landline; EUR 0.42/minute from a mobile phone.

En gl

is h

Notices

Federal Communications Commission Statement This device complies with Part 15 of the FCC Rules. Operation is subject to the following two conditions:

This device may not cause harmful interference, and

This device must accept any interference received including interference that may cause undesired operation.

This equipment has been tested and found to comply with the limits for a Class B digital device, pursuant to Part 15 of the FCC Rules. These limits are designed to provide reasonable protection against harmful interference in a residential installation. This equipment generates, uses and can radiate radio frequency energy and, if not installed and used in accordance with manufacturers instructions, may cause harmful interference to radio communications. However, there is no guarantee that interference will not occur in a particular installation. If this equipment does cause harmful interference to radio or television reception, which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the following measures:

Reorient or relocate the receiving antenna.

Increase the separation between the equipment and receiver.

Connect the equipment to an outlet on a circuit different from that to which the receiver is connected.

Consult the dealer or an experienced radio/TV technician for help.

CAUTION: Any changes or modifications not expressly approved by the grantee of this device could void the users authority to operate the equipment.

FCC Radiation Exposure Statement This equipment complies with FCC radiation exposure limits set forth for an uncontrolled environment. This equipment should be installed and operated with minimum distance 20cm between the radiator & your body.

This transmitter must not be co-located or operating in conjunction with any other antenna or transmitter. If the device is going to be operated in 5.15 ~ 5.25GHz frequency range, then it is restricted to an indoor environment only.

RF Exposure warning The equipment complies with FCC RF exposure limits set forth for an uncontrolled

environment.

The equipment must be co-located or operated in conjunction with any other antenna or transmitter.

English CE Mark Warning

This is a Class B product, in a domestic environment, this product may cause radio interference, in which case the user may be required to take adequate measures.

Canadian Department of Communications Statement This digital apparatus does not exceed the Class B limits for radio noise emissions from digital apparatus set out in the Radio Interference Regulations of the Canadian Department of Communications.

This class B digital apparatus complies with Canadian ICES-003.

NO DISASSEMBLY

The warranty does not apply to the products that have been disassembled by users.

IC Radiation Exposure Statement for Canada This equipment complies with IC radiation exposure limits set forth for an uncontrolled environment. To maintain compliance with IC RF exposure compliance requirements, please avoid direct contact to the transmitting antenna during transmitting. End users must follow the specific operating instructions for satisfying RF exposure compliance.

Operation is subject to the following two conditions:

This device may not cause interference.

This device must accept any interference, including interference that may cause undesired operation of the device.

Declaration of Conformity (R&TTE directive 1999/5/EC) The following items were completed and are considered relevant and sufficient:

Essential requirements as in [Article 3]

Protection requirements for health and safety as in [Article 3.1a]

Testing for electric safety according to [EN 60950]

Protection requirements for electromagnetic compatibility in [Article 3.1b]

Testing for electromagnetic compatibility in [EN 301 489-1] & [EN 301]

Testing according to [489-3]

Effective use of the radio spectrum as in [Article 3.2]

Radio test suites according to [EN 300 440]

En gl

is h

NCC 

:    :   

DO NOT throw this product in municipal waste. This product has been designed to enable proper reuse of parts and recycling. This symbol of the crossed out wheeled bin indicates that the product (electrical and electronic equipment) should not be placed in municipal waste. Check local regulations for disposal of electronic products.

DO NOT throw the battery in municipal waste. This symbol of the crossed out wheeled bin indicates that the battery should not be placed in municipal waste.

REACH Complying with the REACH (Registration, Evaluation, Authorisation, and Restriction of Chemicals) regulatory framework, we published the chemical substances in our products at ASUS REACH website at http://csr.asus.com/english/REACH.htm.

Class 1 Laser Product, Complies with FDA Radiation Performance standards, 21 CFR, Subchapter J.

English

Complies with 21 CFR 1040.10 and 1040.11 except for deviations pursuant to Laser

Notice No. 50, dated June 24, 2007.

Hg

Cd

CrVI

BB

BDE

SJ/T11363-

2006

SJ/T

11363-20062002/95/

EC

Safety Certifications

C-Tick Mark

BSMI Certification

En gl

is h

Check your ASUS GX810 ROG Gaming Mouse package for the following items:

ASUS GX810 ROG Gaming Mouse

Nano USB 2.4 GHz receiver

3 x AAA batteries

Quick Start Guide

Support CD

If any of the above items is damaged or missing, contact your retailer immediately.

Package Contents

Specifications Summary

Product Name GX810

Color Black

Wireless Technology RF 2.4GHz

OS Support Windows XP / Windows Vista / Windows 7

Dimensions (mm) Mouse: 105(L) x 66(W) x 37(H)

Weight Mouse: 82g (without battery)

Buttons / Switches

1 x Left button / Right button / Scroll wheel 1 x Left/Right tilt wheel 2 x Side buttons 1 x DPI switch (Gaming Mode only) / Application switch

(Standard Mode only) 1 x Dual Mode switch

Resolution 800 / 1600 / 2000 / 3200 dpi (adjustable in Gaming Mode only)* * The resolution is fixed at 1200dpi in Standard Mode. The

default resolution for Gaming Mode is 3200dpi.

Input Voltage 1.5V

Battery Requirement 1 to 3 AAA batteries

Specifications are subject to change without prior notice.

10

English

Knowing your ASUS GX810 ROG Gaming Mouse

Your ASUS GX810 ROG Gaming Mouse comes with a left button, a right button, a scroll

wheel, two side buttons, a DPI switch, and a specially designed Dual Mode switch.

1 Left button

2 Right button

3 Scroll wheel / Tilt wheel / Resolution indicator*

4 DPI switch (Gaming Mode only) Application switch (Standard Mode

only)

5 Mouse cover

6 ROG logo

7 Side buttons

8 Slip-resistant rubber design

9 Mouse feet

10 Laser sensor

11 Dual Mode switch**

12 USB dongle compartment

13 Nano USB 2.4 GHz receiver

Status Indications

Flash once 800 dpi

Flash twice 1600 dpi

Flash thrice 2000 dpi

Flash four times 3200 dpi

* Resolution indicator

Icons Indications

Powered off

Standard Mode

Gaming Mode

** Dual Mode switch

23 4

5

6 7

8

7

1

9

12 9

11 9

13

10

En gl

is h

11

Installing the battery

The bundled batteries are not chargeable. If you do not use the mouse for a long time, remove the batteries. Use new or similar-type batteries. Since your GX810 mouse can work with only one battery, you can adjust your

mouse weight through adding or removing one or two batteries. When the mouse power is turned on with low batteries, the orange LED (scroll

wheel) will flash for one minute and turn off immediately when you move your mouse or click a button.

1 2 3

1. Locate the notch near the top end of the cover. Place your thumb over the notch, and then lift the cover upward to remove it.

2. Insert up to three batteries into the slots, taking note of the correct polarity.

3. Press the cover in the direction of the arrows to replace it.

1

English

Customizing your ASUS GX810 ROG Gaming Mouse

The bundled support CD includes a specially designed program which allows you to

customize your GX810 to avail all its features. Place the support CD into the optical

drive and follow the onscreen instructions to install the program.

If Autorun is NOT enabled in your computer, browse the contents of the support CD to locate the setup.exe file. Double-click it to install the program.

Refer to the user manual in the support CD for detailed instructions on how to customize your mouse.

Connecting to PC

2

You can store the USB receiver inside the mouse. To save power, turn off the power when you are not using the mouse.

1. Take out the USB receiver from the USB compartment and then turn the power switch to Standard Mode for normal use or to Gaming Mode for better gaming performance.

2. Insert the USB receiver into an available USB port.

1

USB dongle compartment

Off

Standard Mode

Gaming Mode

En gl

is h

1

Click Start > All Programs > ASUS Gaming Mouse GX810 > ASUS ROG Gaming Mouse GX810 to launch the program.

If the screen below appears, plug your ASUS GX810 Gaming Mouse into your

computers USB port and then click OK to relaunch the program.

Launching the program

Main menu

3

6

7

8

11

17 18

4 5

10 9

1 2

1516 14 1213

19

23 24

22

21

20

1

English

Items Descriptions

1. Displays the current mouse mode you are using.

2. Displays the current battery level.

3. Select a function for each button / action from the dropdown list. * Refer to the table on the next page for more details.

4. Select a resolution from the dropdown list. * This item becomes configurable in Gaming Mode only.

5. Drag the slider to adjust the scroll speed.

6. Drag the slider to adjust the double-click speed.

7. Double-click this icon to test the current double-click speed.

8. Click to save the changes you have made to the selected profile.

9. Click to apply the selected profile.

10. Click to discard the changes you have made and close the screen.

11. Click to save the changes you have made and close the screen.

12. Click to restore the last settings you have made.

13. Click to adjust the mouse sensitivity.

14. Tick to enable or disable changing the mouse sensitivity through adjusting the X-axis and/or Y-axis values.

15. Click to bring up the Macro Settings window. See page 16 for details.

16. Click to bring up the Preferences window. See page 17 for details.

17. Click to create a new profile.

18. Click to import a profile from your computer.

19. Click to export a profile to your computer.

20. Displays the polling rate.

21. Double-click on the profile name to change it.

22. The blue dot next to the item indicates the active profile.

23. Click to duplicate the selected profile.

24. Click to delete the selected profile. * The active profile cannot be deleted.

En gl

is h

1

Items Descriptions

Left Button Mimics the behavior of the standard left mouse button.

Right Button Mimics the behavior of the standard right mouse button.

Scroll Button When selected, press the button to perform the standard scrolling function.

DPI Switch When selected, press the button to select a mouse resolution. * This option only appears in Gaming Mode.

Burst Fire When selected, press the button to do a burst fire in a click-to-attack game, which is the same as triple-clicking the left mouse button. See page 18 for details.

Page Forward When selected, press the button to go to the next page you viewed, which is the same as pressing .

Page Backward When selected, press the button to go to the previous page you viewed, which is the same as pressing .

Macro When selected, press the button to run a command or a series of commands which you can edit though the Macro Profile Management menu. See page 19 for more details.

Launch Program When selected, press the button to launch the program that you specified. See page 20 for details.

One Touch Setting When selected, press the button to launch this program.

My Computer When selected, press the button to open My Computer window.

Web Browser When selected, press the button to launch your default web browser.

E-mail Client When selected, press the button to launch your default email application.

Scroll Left / Right When selected, press the button to scroll leftward / rightward as a tilt wheel does. * This function only works in the Microsoft Office applications under

Windows 7 / Vista.

Mute When selected, press the button to turn the volumes mute mode on/off.

Media Player/ PlayPause

When selected, press the button to launch your default media player or play / pause the playback in an active media player.

Application Switch When selected, press the button to switch among the running applications, which is the same as you press .

Flip-3D When selected, press the button to switch windows using Flip 3D. * This function only works under Windows 7.

1

English

Macro Settings menu

Items Descriptions

1. Click to start recording the keystrokes and click again to stop. * You can record maximum 40 keystrokes for each profile.

2. Tick to ignore all time delays between keystrokes.

3. Displays the recorded keystrokes and the time delays during recording.

4. Click to move up/down the selected keystrokes or time delays.

5. Click to insert the time delay.

6. Click to select the delay time you want to insert.

7. Click to select the repeat mode. Once per click: Select to perform the macro profile once when clicking the mouse

button. Click to repeat, next click to stop: Select to repeat performing the macro profile

when clicking the mouse button and clicking the button again to stop. Click to repeat: Select how many times you want to repeat performing the macro

profile when clicking the mouse button. Select the repeated times from the dropdown list.

Pressed to repeat: Select to repeat performing the macro profile when holding down your mouse button and release the button to stop.

8. Click to save the changes you have made to the selected profile.

5

7

8

11 10 9

1 2

12

13 14

3

4

6

continued on the next page

15

En gl

is h

1

Items Descriptions

1. Tick to show the ROG icon in Windows Notification Area.

2. Tick to enable the onscreen display function.

3. Click to save the changes you have made and close the screen.

4. Click to disregard the changes you have made and close the screen.

Preferences menu

3 4

2 1

Items Descriptions

9. Click to disregard the changes you have made and close the screen.

10. Click to save the changes you have made and close the screen.

11. Click to assign the selected profile to a mouse button.

12. Click to create a new macro profile.

13. Click to deleted the selected macro profile.

14. Click to duplicate the selected macro profile.

15. Double-click on the profile name to change it.

1

English

Burst Fire menu

2

4 3

1

Items Descriptions

1. Click to launch the Burst Fire menu.

2. Click to select the burst fire mode. 3 Rounds Mode: Select to fire three rounds when click the mouse button. 5 Rounds Mode: Select to fire five rounds when click the mouse button. Full Automatic Mode: Select to fully fire automatically when clicking the mouse button

and clicking again to stop.

3. Click to save the changes you have made and close the screen.

4. Click to discard the changes you have made and close the screen.

En gl

is h

1

Macro Settings menu

3

2

1

Items Descriptions

1. Click to launch the Macro Settings menu.

2. Click to assign the selected profile to a mouse button.

3. The blue dot next to the item indicates the active macro profile.

0

English

Program Selection menu

Items Descriptions

1. Click to launch the Program Selection menu.

2. Key in the shortcut name of the program you want to run when clicking the mouse button.

3. Select a program you want to run when clicking the mouse button.

4. Click to disregard the changes you have made and close the screen.

5. Click to save the changes you have made and close the screen.

2

3

1

5 4

En gl

is h

1

Taskbar menu

1

3 2

4 5 6

Items Descriptions

1. The ROG logo appears in the taskbar when the program is properly installed.

2. Click to launch the main menu of this program.

3. Click to visit the ASUS official website.

4. Click to enable / disable the onscreen display function.

5. Click to exit this program.

6. Click to check the application version and the driver version.

English

   

 ASUSTeK COMPUTER INC.

  15  +886-2-2894-3447 +886-2-2890-7798 info@asus.com.tw http://tw.asus.com

 +886-2-2894-3447 

0800-093-456  http://support.asus.com/

techserv/techserv.aspx

 ASUSTeK COMPUTER INC.

  15  +886-2-2894-3447 +886-2-2890-7798 info@asus.com.tw http://tw.asus.com

+86-21-38429911  +86-21-58668722, ext. 9101#  http://support.asus.com/

techserv/techserv.aspx

ASUS COMPUTER INTERNATIONAL

 800 Corporate Way, Fremont, 

California  94539, USA +1-510-739-3777 +1-510-608-4555  http://usa.asus.com

+1-812-282-2787 +1-812-284-0883  http://support.asus.com/

techserv/techserv.aspx

ASUS COMPUTER mbH/

 Harkortstr. 21-23, 40880 Ratingen, 

Germany +49-2102-959911 http://www.asus.de  http://www.asus.de/sales 

+49-1805-010923   +49-1805-010920 / 

 /  / LCD  +49-2102-9599-11  http://support.asus.com/

techserv/techserv.aspx

*    0.14   0.42 

  GX810 ROG 

 Nano USB 2.4 GHz 

 3 x AAA 

 

 

GX810

RF 2.4GHz 

Windows XP / Windows Vista / Windows 7

mm 105L x 66W x 37H       

82g

/

1 x  /  /   1 x /  2 x   1 x DPI /     1 x 

800 / 1600 / 2000 / 3200 dpi  *   *  1200dpi  3200dpi 

REACH  REACHRegistrationEvaluationAuthorisationand 

Restriction  of  Chemicals  REACH  http://csr.asus.com/english/REACH.htm

  RO 

 GX810  DPI    

***  

1

2

3 / / *       

4 DPI      

5

6 ROG 

7

8

9

10

11 **

12

13 Nano USB 2.4 GHz 

800 dpi

1600 dpi

2000 dpi

3200 dpi

**   

1

1

11

1

10

1.5V

13 AAA      

                GX810 ,   

       

1 2 3

1.   

2.   ,

3.   

GX810    

  RO 

     setup.exe    

   

2

   USB         

1.    USB USB        

2.    USB     USB    

1

USB dongle 

  > > GX810 > ROG GX810   GX810 USB        

 OK 

3

6

7

8

11

17 18

4 5

10 9

1 2

1516 14 1213

19

23 24

22

21

20

0

1.

2.

3. /       * 

4.   * 

5.

6.

7.

8.

9.

10.

11.

12.

13.

14.  X  Y 

15.

16. Preferences    

17.

18.

19.

20.

21.

22.

23.

24.   * 

1

DPI   *  

Burst Fire urst fire       18    

[] / []     Windows 7 / Vista  Microsoft Office 

/

/

/     

    

Flip-3D windows Flip 3D          *   Windows   7 

1. ,

*  40    

2.

3.

4.

5.

6.

7.

  ,

 ,

  

  ,

8.

5

7

8

11 10 9

1 2

12

13 14

3

4

6

15

1.  Windows  GX810 

2.  DPI 

3.

4.

Preferences 

3 4

2 1

9.

10.

11.

12.

13.

14.

15.

Burst Fire 

2

4 3

1

1. Burst Fire      

2. urst fire      

 3 

 5 

 ,

3.

4.

3

2

1

1.

2.

3.

1.

2.

3.

4.

5.

2

3

1

5 4

1

3 2

4

5 6

1. , GX810 ROG 

2.

3.

4. /    

5.

6.

0

ASUSTeK COMPUTER INC.

356 886-2-2894-3447

0800-093-456 886-2-2890-7698 http://tw.asus.com

ASUS COMPUTER INTERNATIONAL

800CorporateWay,Fremont,

CA94538,USA +1-510-739-3777 +1-510-608-4555 http://usa.asus.com

+1-812-282-2787 +1-812-284-0883 http://support.asus.com/

ASUS COMPUTER mbH/

Harkort Str. 21-23, D-40880

Ratingen,Germany +49-2102-959911 http://www.asuscom.de http://www.asuscom.

de/sales

+49-1805-010923*

+49-1805-010920/ //LCD*

+49-2102-9599-11 http://support.asus.com/

ASUSTEK COMPUTERSHANHAI CO.,LTD.

508 86-21-54421616

400-600-6655

400 021-60911839

86-21-54420088 http://www.asus.com.cn/

* 0.14 0.42

1

Hg

Cd

CrVI

BB

BDE

SJ/T 11363-2006

SJ/T 11363-2006 2002/95/EC

REACH REACHRegistrationEvaluationAuthorisationand

RestrictionofChemicals REACHhttp://csr.asus.com/english/REACH.htm

GX810ROG

NanoUSB2.4GHz

3xAAA

GX900

RF2.4GHz

WindowsX/WindowsVista/Windows7

mm 105Lx66Wx37H

82g

/

1x// 1x/ 2x 1xDI/ 1x

800/1600/2000/3200dpi * * 1200dpi 3200dpi

1.5V

13 AAA

RO

GX810 DI

***

2

3 / / *

4 DI

5

6 ROG

7

9

**

2

3 NanoUSB2.4GHz

800dpi

1600dpi

2000dpi

3200dpi

*

**

1

1

11

1

10

GX810

1 2 3

1.

2.

3.

GX810

RO

setup.exe

2

USB

1. USB USB

2. USB USB

1

USBdongle

>> GX810> ROGGX810 GX810 USB

OK

3

6

7

8

11

17 18

4 5

10 9

1 2

1516 14 1213

19

23 24

22

21

20

.

2.

3. / *

4. *.

5.

6.

7.

.

9.

.

.

2.

3.

4. XY

5. 16

6. references 17

7.

.

9.

2.

2.

22.

23.

24. *

DPI *

Burst Fire urst fire 18

19

20

[] / [] Windows7/Vista MicrosoftOffice

/

/

/

Flip-3D windows Flip 3D * Windows 7

.

* 40

2.

3.

4. /

5.

6.

7.

.

5

7

8

11 10 9

1 2

12

13 14

3

4

6

15

0

. WindowsGX810

2. DI

3.

4.

Preferences

3 4

2 1

9.

.

.

2.

3.

4.

5.

1

Burst Fire

2

4 3

1

. Burst Fire

2. urst fire

3

5

3.

4.

3

2

1

.

2.

3.

.

2.

3.

4.

5.

2

3

1

5 4

1

3 2

4

5 6

. GX810ROG

2.

3.

4. /

5.

6.

Uivatelsk.Pruka

ASUS.GX810.ROG.hern.my

56

etina

Kontaktn.informace.spolenosti.ASUS

ASUSTeK.COMPUTER.INC. Adresa 5 ie ad eit aiei aian 5 elefn +886843447 Fax +88680778 Email inf@ass.cm.t Webvstrnky .ass.cm.t

Technick.podpora elefn +86384 dranline srt.ass.cm

ASUS.COMPUTER.INTERNATIONAL.Amerika Adresa 800 rrate Way Fremnt A 453 A elefn +50733777 Fax +506084555 Webvstrnky sa.ass.cm

Technick.podpora elefn +88787 Faxtechnickdry +8840883 dranline srt.ass.cm

ASUS.COMPUTER.GmbH.Nmecko a Rakousko. . Adresa arkrt tr. 3 40880 atinen ermany Fax +405 Webvstrnky .ass.de Kntaktnline .ass.de/sales

Technick.podpora elefn(st) +4805003* elefn(ystm/ntebk/Eee/) +4805000* Faxtechnickdry +405 dranline srt.ass.cm

*.EUR.0,14/min..z.pevn.st.v.Nmecku;.EUR.0,42/min..z.mobilnho.telefonu.

57

e t

in a

ZkntrljtezdakrabicesaservhernmyAX80Obsahjensledjc lky.

. ASUS GX810 ROG hern my. . . . . Pima Nano US 2,4 GHz. . . . .

. 3.x.baterieAAA . Strun.pruka . Podprn.disk.CD

kdjenkterzlekkzenanebchybaksebratenardejce.

Obsah.krabice

Pehled.technickch.da

Nzev.modelu X80

arva ern

ezdrtov.technologie F4z

Podporovan.operan. systmy WindsX/WindsVista/Winds7

Rozmry.mm My:05()x66(W)x37() Hmotnost My:8(bezbaterie)

Tlatka./.Pepnae

xevtlatk/ravtlatk/lvacklek xlev/ravnaklctlatk xbntlatka xenaI(zehernreim)/enaalikac(ze

standardnreim) xenadlnhreim

Rozlien

800/600/000/300di(nastavitelnzevhernm reim)* *Vestandardnmreimjerzlienevnnastavenna00

di.Vchzrzlienrhernreimje300di. Vstupn.napt .5V

Poadovan.baterie a3baterieAAA

dajemhbtbezedchzhzrnnzmnny.

58

etina

Seznmen.s.laserovou.hern.my.ASUS.GX810.ROG

atAX80Ohernmyjevybavenalevmtlatkemravmtlatkem svacmklekemdvmabnmitlatkyenaemIaseciln navrenmenaemreim.

1 evtlatk

2 ravtlatk

3 lvacklek/Naklcklek/ indiktrrzlien*

4 ena I (ze hern reim) ena alikac (ze standardn

reim) 5 Krytmyi 6 O 7 bntlatka 8 rtisklzvryvdesin 9 Nhamyi 10 aservsnma 11 enadlnhreim** 12 ihrdkarhardarvklB 13 ijmaNanB4z

Stav Indikace Bliknejedn 800di

Bliknedvakrt 600di

Bliknetikrt 000di

Bliknetyikrt 300di

*. indiktor.rozlien

Ikony Indikace Najenvynt

tandardnreim

ernreim

**. .pepna.dulnho.reimu

23 4

5

6 7

8

7

1

9

12 9

11 9

13

10

5

e t

in a

Vloen.baterie

ilenbaterienejsnabjec. Nebdetelimydeldbvatvyjmtebaterie. ijtenvbaterienebbateriestejnhty. VzhledemktmetatmyX80mefnvatzesjednbateri

meteravithmtnstmyiidnmnebdebrnmjednnebdv bateri.

Kdyjenajenmyizantabateriejstmvybithybemmyneb klentmnanktertlatkblikranvindiktrE(svacklek) jednmintaihnedzhasne.

1 2 3

. Vyhledejtetrbinvblzkstihrnhkrajekryt.ltealecnatrbin tmkrytzvednteasejmte.

. Vltetibateriedihrdektakabybyladdrenasrvnlarita.

3. Nasatekrytvesmriek.

60

etina

Pizpsoben.ASUS.GX810.ROG.hern.myi

ilendrndiskbsahjesecilnvytvenrramktervm mjenaknfirvatX80Otakabybylmnvyvatvechnyjej fnkce.Vlteddandrndiskdtickjedntkyadlekynna brazvcenainstaljterramktermjeizsbitvaimy.

kdvtaiNENaktivvnafnkceatmatickhstnvyhledejtena disksbrset.exe.klenmnainstaljterram.

drbnkynyrizsbenmyivizivatelskrkanadrnm disk.

Pipoen.k.POTAI

2

ijmaBmetechvvatvnitmyi. Jestliemynevtevyntenajenabyseetilaenerie.

. VyjmteijmaBzihrdky Batmenteena dnrmlnhreimrbn vnnebdhernhreimr lehernvkn.

. ZasteijmaBd vlnhrtB.

1

ihrdkarhardarvklB

Vynt

tandardn reim

ernreim

6

e t

in a

1

KlentmnaStart>All.Programs.Vechny.programy>ASUS.Gaming.Mouse. GX810.ASUS.hern.my.GX810>ASUS.ROG.Gaming.Mouse.GX810.ASUS.ROG. hern.my.GX810ssterram. kdsezbraznsledjcbrazvkaijteAX80hernmykrtB taeatmklentmnaOKznvssterram.

Sputn.programu

Hlavn.nabdka

3

6

7

8

11

17 18

4 5

10 9

1 2

1516 14 1213

19

23 24

22

21

20

6

etina

Poloky Popis

1. Zbrazjeaktlnvanreimmyi.

2. Zbrazjeaktlnrvebaterie.

3. Vybertefnkcirkadtlatk/akcizrzevrachseznam. *aldrbnstiviztablkanansledjcstran.

4. Vyberterzlienvrzevracmseznam. *tlklzeknfirvatzevhernmreim.

5. etaenmsvnkravterychlstsvn.

6. etaenmsvnkravterychlstklen.

7. klenmnattiknrvetetestrychlstiklen.

8. Klentmltervedenzmnydvybranhrfil.

9. Klentmijtevybranrfil.

10. Klentmzrtervedenzmnyazavetebrazvk.

11. Klentmltervedenzmnyazavetebrazvk.

12. Klentmbnvteslednrvedennastaven.

13. Klentmravtecitlivstmyi.

14. Zakrtntmaktivjtenebdeaktivjtezmncitlivstimyirstednictvmnastaven hdntsyXa/nebsyY.

15. KlentmzbrazteknMacrettins(Nastavenmakra).aldrbnstiviz strana6.

16. Klentmzbrazteknreferences(edvlby).aldrbnstivizstrana7.

17. Klentmvytvtenvrfil.

18. Klentmnaimrtjeterfilztae.

19. Klentmnaexrtjeterfildtae.

20. Zbrazjefrekvencidtazvn.

21. hcetelizmnitnzevrfilekleejtenanm.

22. Mdrtekavedlelkyznajeaktivnrfil.

23. Klentmdlikjetevybranrfil.

24. Klentmdstrantevybranrfil. *Aktivnrfilnelzedstranit.

63

e t

in a

Poloky Popis Lev.tlatko Navzjechvnstandardnhlevhtlatkamyi.

Prav.tlatko Navzjechvnstandardnhravhtlatkamyi.

Tlatko. posouvn

Jelivybrnstiskntmtlatkarvedetefnkcistandardnh svn.

Pepna.DPI Jelivybrnstiskntmtlatkavyberterzlienmyi. *atvlbasebjevzevhernmreim.

Sriov.palba Jelivybrnstiskntmtlatkarvedetesrivalbvehe klentmtitcjestejnjaktrjitklenlevmtlatkemmyi. aldrbnstivizstrana8.

O.strnku.vped Jelivybrnstiskntmtlatkaejdetenadalzbrazvanstrnk cjestejnjakstisknt .

O.strnku.zpt Jelivybrnstiskntmtlatkaejdetenaedchzzbrazvan strnkcjestejnjakstisknt .

Makro Jelivybrnstiskntmtlatkarvedetekaznebadkaz ktermeteravvatrstednictvmnabdkyMacrrfile Manaement(rvarfilmakra).aldrbnstivizstrana.

Spustit.program Jelivybrnstiskntmtlatkasstterenrram.al drbnstivizstrana0.

Nastaven.ednm. dotykem

Jelivybrnstiskntmtlatkassttetentrram.

Tento.pota Jelivybrnstiskntmthttlatkateveteknentta.

Webov.prohle Jelivybrnstiskntmthttlatkassttevchzebvrhle.

Klient poty. Jelivybrnstiskntmthttlatkassttevchzemailvalikaci.

Posunout.doleva./. doprava

Jelivybrnstiskntmtlatkasesnetedleva/dravadle naklchkleka. *atfnkcefnjezevalikacchMicrsftOfficeveranm

systmWinds7/Vista.

Ztlumit Jelivybrnstiskntmthttlatkazanete/vynetereimztlmen hlasitsti.

Pehrva.mdi/ hrt.pauza

Jelivybrnstiskntmtlatkassttevchzehrvamdineb ehrajete/zastavteehrvnvaktivnmehrvaimdi.

Pepna.aplikac Jelivybrnstiskntmtlatkaenejtemezistnmialikacemi cjestejnjakstisknt .

Pepnn.oken.3D JelivybrnstiskntmtlatkaenejteknamcFli3 (ennken3). *atfnkcefnjezeveranmsystmWinds7.

64

etina

Nabdka.Macro.Settings.Nastaven.makra

Poloky Popis

1. Klentmzanetenahrvatklvesvhzyadalmstiskntmnahrvnknte. *rkadrfilmetenahrtmaximln40klvesvchhz.

2. Zakrtntmbdinrvnyvechnazdnmeziklvesvmihzy.

3. Zbrazjenahranklvesvhzyazdnbhemnahrvn.

4. Klentmmetesvatvybranklvesvhzynebzdnnahrneb dl.

5. Klentmvltezdn.

6. Klentmvybertezdnkterchcetevlit.

7. Klentmvybertereimakvn. Jednou.na.klepnut:.Klentmbderfilmakrarvedenklentmnatlatk

myi. Klepnutm.zopakovat,.dalm.klepnutm.zastavit:.Vbremttmnstibde

rfilmakrazakvnklentmnatlatkmyiadalmklentmbdezastaven. Klepnutm.zopakovat:.Vyberteklikrtchcetezakvatrvedenrfilmakrai

klentnatlatkmyi.Vyberteetakvnvrzevracmseznam. Stisknutm.opakovat:.Vbremttmnstibderfilmakrazakvn

stiskntmadrenmtlatkamyiavlnnmtlatkabdezastaven.

8. Klentmltervedenzmnydvybranhrfil.

5

7

8

11 10 9

1 2

12

13 14

3

4

6

pokraovn na dal stran

15

65

e t

in a

Poloky Popis

1. ZakrtntmbdeiknaOzbrazenavznamvacblastisystmWinds.

2. Zakrtntmaktivjtefnkcizbrazennabrazvce.

3. Klentmltervedenzmnyazavetebrazvk.

4. Klentmzrtervedenzmnyazavetebrazvk.

Preferences.menu.Nabdka.Pedvolby

3 4

2 1

Poloky Popis 9. Klentmzrtervedenzmnyazavetebrazvk.

10. Klentmltervedenzmnyazavetebrazvk.

11. Klentmiatevybranrfiltlatkmyi.

12. Klentmvytvtenvrfilmakra.

13. Klentmdstrantevybranrfilmakra.

14. Klentmdlikjetevybranrfilmakra.

15. hcetelizmnitnzevrfilekleejtenanm.

66

etina

Nabdka.urst.Fire.Sriov.palba

Poloky Popis

1. KlentmssttenabdkBrstFire(rivalba).

2. Klentmvybertereimsrivalby. Reim.3.salv:.mtvbremvylteklentmnatlatkmyitisalvy. Reim.5.salv:.mtvbremvylteklentmnatlatkmyitsalv. Pln.automatick.reim:.mtvbrembdeklentmnatlatkmyialba

zcelaatmatickadalmklentmbdezastavena.

3. Klentmltervedenzmnyazavetebrazvk.

4. Klentmzrtervedenzmnyazavetebrazvk.

2

4 3

1

67

e t

in a

Nabdka.Macro.Settings.Nastaven.makra

Poloky Popis

1. KlentmssttenabdkMacrettins(Nastavenmakra).

2. Klentmiatevybranrfiltlatkmyi.

3. Mdrtekavedlelkyznajeaktivnrfilmakra.

3

2

1

68

etina

Nabdka.Program.Selection.Vbr.programu

Poloky Popis

1. Klentmssttenabdkrramelectin(Vbrrram).

2. Zadejtenzevzstcerramkterchceteklentmtlatkamyisstit.

3. Vyberterramkterchceteklentmtlatkamyisstit.

4. Klentmzrtervedenzmnyazavetebrazvk.

5. Klentmltervedenzmnyazavetebrazvk.

2

3

1

5 4

6

e t

in a

Nabdka.hlavnho.panelu

1

3 2

4 5 6

Poloky Popis

1. KdyjerramsrvnnainstalvnnahlavnmanelsezbrazlO.

2. Klentmssttehlavnnabdkthtrram.

3. KlentmnavtvteficilnebvstrnkyslenstiA.

4. Klentmaktivjte/deaktivjetefnkcizbrazennabrazvce.

5. Klentmkntetentrram.

6. Klentmzkntrljeteverzialikaceavladae.

70

etina

Manuel de lutilisateur

Souris de jeu ASUS ROG GX810

Franais

Informations de contact

ASUSTeK COMPUTER INC. Adresse 15 Li-Te Road, Peitou, Taipei, Taiwan 11259 Tlphone +886-2-2894-3447 Fax +886-2-2890-7798 E-mail info@asus.com.tw Site Web www.asus.com.tw

Support technique Telephone +86-21-38429911 Online support support.asus.com

ASUS COMPUTER INTERNATIONAL (Amrique) Adresse 800 Corporate Way, Fremont, CA 94539, USA Tlphone +1-510-739-3777 Fax +1-510-608-4555 Site Web usa.asus.com

Support technique Tlphone +1-812-282-2787 Fax +1-812-284-0883 Support en ligne support.asus.com

ASUS France SARL Adresse 10, Alle de Bienvenue, 93160 Noisy Le Grand, France Tlphone +33 (0) 1 49 32 96 50 Site Web www.france.asus.com

Support technique Tlphone +33 (0) 8 21 23 27 87 Fax +33 (0) 1 49 32 96 99 Web support.asus.com

Fr an

a is

Vrifiez que la bote de votre souris ASUS ROG GX810 inclut les lments suivants :

Souris de jeu ASUS ROG GX810

Rcepteur nano USB 2.4 GHz

3 x piles AAA

Guide de dmarrage rapide

CD de support

Si lun des lments ci-dessus est endommag ou manquant, contactez votre revendeur.

Contenu de la bote

Rsum des spcifications

Nom du produit GX810

Couleur Black

Technologie sans fil RF 2.4GHz

Systmes dexploitation Windows XP / Windows Vista / Windows 7

Dimensions (mm) Souris : 105(L) x 66(P) x 37(H)

Poids Souris : 82g (sans piles)

Boutons / Interrupteurs

1 x bouton gauche / bouton gauche / molette de dfilement 1 x Molette inclinable vers la gauche et la droite 2 x boutons latraux 1 x bouton DPI (rserv au mode jeu) / bouton Application

(rserv au mode standard) 1 x interrupteur de slection de mode

Rsolution 800 / 1600 / 2000 / 3200 dpi (ajustable en mode jeu uniquement)* * La rsolution est fixe 1200dpi en mode standard. La rsolution

par dfaut du mode jeu est de 3200dpi.

Tension dentre 1.5V

Piles 1 3 piles AAA

Les spcifications sont sujettes changement sans notification pralable.

Franais

Faire connaissance avec la souris de jeu ASUS GX810

Votre souris de jeu ASUS ROG GX810 intgre un bouton droit, un bouton gauche, une

molette de dfilement, deux boutons latraux, un bouton DPI ainsi quun interrupteur

de slection de mode.

1 Bouton gauche

2 Bouton droit

3 Molette de dfilement inclinable vers la gauche ou la droite / Indicateur de rsolution*

4

Bouton DPI (utilisable en mode jeu uniquement) Bouton Application (utilisable en mode jeu uniquement)

5 Couvercle

6 Logo ROG

7 Boutons latraux

8 Design antidrapant

9 Patins de la souris

10 Capteur laser

11 Interrupteur de slection de mode**

12 Compartiment pour dongle USB

13 Rcepteur Nano USB 2.4 GHz

tat Indications

Clignote une fois 800 dpi

Clignote deux fois 1600 dpi

Clignote trois fois 2000 dpi

Clignote quatre fois 3200 dpi

* indicateur de rsolution

Icnes Indications

teinte

Mode standard

Mode jeu

** Interrupteur de slection de mode

23 4

5

6 7

8

7

1

9

12 9

11 9

13

10

Fr an

a is

Installer les piles

Les piles incluses ne sont pas rechargeables. Lors dune inutilisation prolonge de la souris, retirez les piles. Nutilisez que des piles neuves et de mme type. Votre souris GX810 pouvant fonctionner avec une seule pile, vous pouvez ajuster

le poids de la souris en ajoutant ou tant une ou deux piles. Lorsque le niveau de charge des piles est faible, le voyant lumineux de la molette

de dfilement clignote pendant environ une minute et steint immdiatement lorsque vous dplacez la souris ou cliquez sur lun de ses boutons.

1 2 3

1. Localisez lencoche situe larrire du couvercle. Placez votre pouce sur lencoche, puis soulevez le couvercle pour le retirer.

2. Insrez les trois piles en prenant garde bien respecter la polarit.

3. Replacez le couvercle du compartiment pile.

Franais Personnaliser votre souris ASUS ROG GX810

Le CD accompagnant votre souris intgre un programme spcialement conu pour

personnaliser et profiter de toutes les fonctions de votre souris GX810. Placez le CD

de support accompagnant votre souris dans le lecteur optique de votre ordinateur

puis suivez les instructions apparaissant l'cran pour installer le programme vous

permettant de personnaliser la souris.

Si la fonction d'Excution automatique n'est pas active sur votre ordinateur, parcourez le contenu du CD de support pour localiser le fichier setup.exe. Double-cliquez sur ce fichier pour lancer l'installation du programme.

Consultez les sections suivantes de ce manuel d'utilisation pour plus de dtails sur la personnalisation de votre souris.

Connexion un ordinateur

2

Vous pouvez placer le rcepteur USB dans la souris. Pour conomiser de lnergie, teignez la souris lorsque vous ne lutilisez pas.

1. Retirez le rcepteur USB de son emplacement de stockage et placez l'interrupteur d'alimentation en mode Standard pour une utilisation normale ou en mode Jeu pour de meilleures performances de jeu.

2. Insrez le rcepteur USB dans lun des ports USB de votre ordinateur.

1

Compartiment pour dongle USB

Arrt

Mode standard

Mode jeu

Fr an

a is

Cliquez sur Dmarrer > Tous les programmes > ASUS Gaming Mouse GX810 > ASUS ROG Gaming Mouse GX810 pour lancer lapplication.

Si la bote de dialogue ci-dessous apparat, connectez le rcepteur USB de votre souris

sur lun des ports USB de votre ordinateur USB puis cliquez sur OK pour relancer le

programme.

Utiliser le programme de configuration

Menu principal

3

6

7

8

11

17 18

4 5

10 9

1 2

1516 14 1213

19

23 24

22

21

20

Franais

lments Descriptions

1. Affiche le mode dutilisation actuel de la souris.

2. Affiche le niveau de charge des piles.

3. Zone de personnalisation des boutons de la souris * Consultez le tableau de la page suivante pour plus de dtails.

4. Menu droulant de slection de la rsolution. * Cet option nest disponible que si la souris est configure en mode jeu.

5. Curseur dajustement de la vitesse de dfilement.

6. Curseur dajustement de la vitesse du double-clic.

7. Test de la vitesse du double-clic.

8. Cliquez pour enregistrer les modifications apportes au profil slectionn.

9. Cliquez pour appliquer les modifications apportes au profil slectionn.

10. Cliquez pour annuler les modifications apportes et quitter.

11. Cliquez pour enregistrer les modifications apportes et quitter.

12. Cliquez pour restaurer les paramtres prcdents.

13. Cliquez pour rgler la sensibilit de la souris.

14. Cochez cette case pour activer ou dsactiver la modification de la sensibilit de la souris via le rglage des axes X et Y.

15. Cliquez pour afficher la page de rglage des macros. Voir page 16 pour plus de dtails.

16. Cliquez pour afficher la page des prfrences. Voir page 17 pour plus de dtails.

17. Cliquez pour crer un nouveau profil.

18. Cliquez pour charger un profil stock sur votre ordinateur.

19. Cliquez pour exporter un profil sur votre ordinateur.

20. Affiche la frquence de scrutation.

21. Double-cliquez sur le nom du profil pour le renommer.

22. Le point bleu indique que le profil est actif.

23. Cliquez pour dupliquer le profil slectionn.

24. Cliquez pour supprimer le profil slectionn. * Un profil actif ne peut pas tre supprim.

Fr an

a is

lments Descriptions

Bouton gauche Permet dmuler un clic gauche de la souris.

Bouton droit Permet dafficher le menu contextuel normalement attribu un clic droit de souris.

Bouton de dfilement

Permet dmuler le dfilement de molette de souris.

Bouton DPI Permet de slectionner la rsolution de la souris. * Cette option nest disponible quen mode jeu.

Tir en rafale Permet deffectuer un tir en rafale dans un jeu o le clic de la souris est utilis pour tirer. Cette action est identique un triple clic gauche rapide de la souris. Voir page 18 pour plus de dtails.

Piste suivante Permet de retourner la page suivante. Ceci est lquivalent de la combinaison de touches .

Page prcdente Permet de retourner la page prcdente. Ceci est lquivalent de la combinaison de touches .

Macro Permet dexcuter une commande ou une srie de commande pouvant tre dites via le menu ddition des macros. Voir page 19 pour les dtails.

Lanceur de programme

Permet dexcuter un programme spcifique. Voir page 20 pour les dtails.

One Touch Permet dexcuter le programme One Touch.

Poste de travail Permet douvrir la fentre Poste de travail/Ordinateur (selon le systme dexploitation).

Navigateur Web Permet dexcuter votre navigateur Web par dfaut.

E-mail Permet douvrir votre application de messagerie par dfaut.

Molette [gauche] / [droite]

Permet dmuler linclinaison latrale gauche ou droite de la molette de la souris. REMARQUE : cette fonction ne fonctionne quavec les applications Microsoft Office sous Windows 7 / Vista.

Sourdine Permet dactiver / dsactiver le son.

Lecteur multimdia

Permet douvrir votre lecteur multimdia par dfaut ou lire/suspendre la lecture dun fichier en cours de lecture.

Bouton Application

Permet de basculer entre les diffrentes applications en cours dexcution. Ceci est lquivalent de la combinaison de touches .

Rotation 3D Permet de basculer entre les diffrentes fentre actives avec loutil Rotation 3D. * Cette option ne fonctionne que sous Windows 7.

0

Franais

Menu ddition des macros

lments Descriptions

1. Dmarre/arrte lenregistrement des frappes au clavier. * Vous pouvez enregistrer un maximum de 40 frappes pour chaque profil.

2. Cochez cette case pour ignorer les dlais dattente entre chaque frappe.

3. Cliquez pour afficher le jeu dinstructions enregistr.

4. Cliquez pour monter ou descendre la frappe ou le dlai slectionn.

5. Cliquez pour insrer un dlai dattente.

6. Cliquez pour dfinir le dlai dattente insrer.

7. Cliquez pour slectionner le mode de rptition. Once per click (Une fois par clic) : permet dutiliser le profil macro lors de la pression

de lun des boutons de la souris. Click to repeat, next click to stop (Cliquer pour rpter et arrter) : appuyez une fois

pour utiliser le profil macro puis une seconde fois pour larrter. Click to repeat (Cliquer pour rpter) : slectionnez le nombre de rptitions

effectuer. Vous pouvez choisir le nombre de rptitions partir du menu droulant. Pressed to repeat (Maintenir enfonc pour rpter) : permet dutiliser le profil macro

lorsque lun des boutons de la souris est maintenu enfonc, et ce jusqu ce que le bouton soi relch.

8. Cliquez pour enregistrer les modifications apportes au profil.

5

7

8

11 10 9

1 2

12

13 14

3

4

6

continue la page suivante

15

1

Fr an

a islments Descriptions

1. Cochez cette case pour afficher licne ROG dans la zone de notification de Windows.

2. Cochez cette case pour afficher lcran OSD.

3. Cliquez pour enregistrer les modifications apportes et fermer lcran.

4. Cliquez pour annuler les modifications apportes et fermer lcran.

Menu des prfrences

3 4

2 1

lments Descriptions

9. Cliquez pour annuler les modifications apportes et fermer lcran.

10. Cliquez pour enregistrer les modifications apportes et fermer lcran.

11. Cliquez pour assigner le profil slectionn un bouton de souris.

12. Cliquez pour crer un nouveau profil.

13. Cliquez pour supprimer le profil slectionn.

14. Cliquez pour dupliquer le profil slectionn.

15. Double-cliquez sur le profil pour le renommer.

Franais

Menu de configuration de tir

2

4 3

1

lments Descriptions

1. Cliquez pour ouvrir le menu de configuration de tir.

2. Cliquez pour slectionnez le mode de tir. 3 Rounds Mode (Mode 3 balles) : slectionnez ce mode pour tirer une salve de 3 balles lors de la pression de lun des boutons de la souris. 5 Rounds Mode (Mode 5 balles) : slectionnez ce mode pour tirer une salve de 5 balles lors de la pression de lun des boutons de la souris. Full Automatic Mode (Mode de tir automatique) : slectionnez ce mode pour un tir

automatique et continu jusquau relchement du bouton de la souris.

3. Cliquez pour enregistrer les modifications apportes et fermer lcran.

4. Cliquez pour annuler les modifications apportes et fermer lcran.

Fr an

a is

Menu de configuration des macros

3

2

1

lments Descriptions

1. Cliquez pour ouvrir le menu de configuration des macros.

2. Cliquez pour assigner le profil slectionn un bouton de souris.

3. Le point bleu indique que le profil est actif.

Franais

Menu de slection de programme

lments Descriptions

1. Cliquez pour le menu de slection de programme.

2. Entrez le nom ou une partie du nom du programme lancer lors de la pression dun bouton spcifique de la souris.

3. Slectionnez programme lancer lors de la pression dun bouton spcifique de la souris.

4. Cliquez pour annuler les modifications apportes et fermer lcran.

5. Cliquez pour enregistrer les modifications apportes et fermer lcran.

2

3

1

5 4

Fr an

a is

Menu de la barre des tches

1

3 2

4 5 6

lments Descriptions

1. Le logo ROG apparat dans la zone de notification lorsque le programme est correctement install.

2. Cliquez pour ouvrir le menu principal.

3. Cliquez pour visiter le site Web officiel dASUS.

4. Cliquez pour activer / dsactiver laffichage de lcran OSD.

5. Cliquez pour quitter le programme.

6. Cliquez pour la version du programme et du pilote.

Franais

Benutzerhandbuch

ASUS GX810 ROG Gaming-Maus

D eutsch

Kontaktinformationen

ASUSTeK COMPUTER INC. Adresse 15 Li-Te Road, Peitou, Taipei, Taiwan 11259 Telefon +886-2-2894-3447 Fax +886-2-2890-7798 E-Mail info@asus.com.tw Webseite www.asus.com.tw

Technische Untersttzung Telefon +86-21-38429911 Online-Support support.asus.com

ASUS COMPUTER INTERNATIONAL (Amerika) Adresse 800 Corporate Way, Fremont, CA 94539, USA Telefon +1-510-739-3777 Fax +1-510-608-4555 Webseite usa.asus.com

Technische Untersttzung Telefon +1-812-282-2787 Support-Fax +1-812-284-0883 Online-Support support.asus.com

ASUS COMPUTER GmbH (Deutschland & sterreich) Adresse Harkort Str. 21-23, D-40880 Ratingen, Germany Fax +49-2102-959911 Webseite www.asus.de Online-Kontakt www.asus.de/sales

Technische Untersttzung Telefon (Komponenten) +49-1805-010923* Telefon (System/Notebook/Eee/LCD) +49-1805-010920* Support-Fax +49-2102-9599-11 Online-Support support.asus.com

* 0,14Euro/Minute fr Anrufe aus dem deutschen Festnetz, Mobilfunk max. 0,42 Euro/Minute.

D eu

ts ch

berprfen Sie die Verpackung der ASUS GX810 Spielemaus auf folgenden Inhalt:

ASUS GX810 Gaming Mouse

Nano USB 2.4 GHz-Empfnger

3 x AAA-Batterien

Schnellstartanleitung

Support-CD

Wenn ein Teil fehlt oder beschdigt ist, kontaktieren Sie bitte Ihren Hndler.

Verpackungsinhalt

Technische Daten

Modellname GX810

Farbe Schwarz

Wireless-Technologie RF 2,4GHz

Unterst. Betribssysteme Windows XP / Windows Vista / Windows 7

Abmessungen (mm) Mouse: 105 (L) x 66 (B) x 37 (H)

Gewicht Maus: 82g (ohne Batterien)

Tasten/Schalter

1 x Linke Taste/rechte Taste/Scroll-Rad 1 x Links/rechts Kipprad 2x Seitentasten 1 x DPI-Taste (nur im Spielemodus)/ Anwendungumschalter (nur bei Standardmodus) 1 x Dual-Modus-Umschalter

Auflsung 800/1600/2000/3200 dpi (nur im Spielemodus einstellbar) *Feste Standardeinstellung im Standardmodus: 3200dpi

Versorgungsspannung 1,5V

Stromversorgung 1-3 AAA-Batterien

Die technischen Daten knnen sich ohne vorherige Ankndigung ndern.

0

D eutsch

Kennenlernen Ihrer ASUS GX810 Spielemaus

Ihre ASUS GX810-Maus ist mit linker, rechter, einem Scroll-Rad, zwei Seitentasten,

einer speziellen DPI-Taste und einen speziell entwickelten Dual-Modus-Umschalter

ausgestattet.

1 Linke Taste

2 Rechte Taste

3 Scroll-Rad/Kipprad, Auflsungsanzeige

4 - DPI-Umschalter (nur im Spielemodus) - Anwendungsumschalter (nur im Standardmodus)

5 Batteriefachabdeckung

6 POG-Logo

7 Seitentasten

8 Antirutschbeschichtung

9 Gleitfe

10 Laser-Sensor

11 Dual-Modus-Umschalter

12 USB-Dongle-Fach

13 Nano USB 2,4GHz-Empfnger

Status Beschreibung

Einmal blinken 800 dpi

Zweimal blinken 1600 dpi

Dreimal blinken 2000 dpi

Viermal blinken 3200 dpi

* Auflsungs-LED-Anzeige

** Dual-Modus-Umschalter

23 4

5

6 7

8

7

1

9

12 9

11 9

13

10

Symbol Anzeige

Ausgeschaltet

Standardmodus

Spielemodus

1

D eu

ts ch

Einlegen der Batterien

Die mitgelieferten Batterien sind nicht wiederaufladbar. Bei lngerer Nichtbenutzung entfernen Sie bitte die Batterien. Verwenden Sie neue oder hnlich Batterien. Da Ihre GX810-Maus auch mit nur einer Batterie arbeiten kann, knnen Sie das

Mausgewicht durch hinzufgen oder Entfernen einer oder zweier Batterien einstellen.

Wenn Sie Ihre Maus mit fast entladenen Batterien einschalten, wird die orange LED (am Scroll-Rad) fr eine Minute lang blinken und erlschen, sobald Sie die Maus bewegen oder eine Maustaste drcken.

1 2 3

1. Suchen Sie die Kerbe am oberen Ende der Abdeckung. Legen Sie Ihren Daumen auf die Kerbe und heben Sie die Abdeckung nach oben, um sie zu entfernen.

2. Legen Sie bis zu 3 Batterien in das Fach ein und beachten Sie dabei die richtige Polung.

3. Drcken Sie die Abdeckung in Pfeilrichtung, um sie zu schlieen.

D eutsch

Einrichten Ihrer ASUS GX810 ROG Spielemaus

Die im Lieferumfang enthaltene Support-Cd enthlt ein speziell entwickeltes

Programm, ber das Sie Ihre GX810 so einrichten knnen, dass alle Funktionen

verfgbar sind. Legen Sie die Support-CD in das optische Laufwerk und folgen Sie den

Bildschirmanweisungen, um die Software fr die Einstellung der Maus zu installieren.

Anschluss an einen PC

2

Sie knnen den Empfnger in der Maus aufbewahren. Um Energie zu sparen, schalten Sie bitte den Schalter aus, wenn Sie die Maus nicht benutzen.

1. Nehmen Sie den Empfnger aus dem Fach und schieben Sie den Schalter auf Standard Mode fr normale Benutzung oder auf Gaming Mode fr bessere Leistung bei Spielen.

2. Stecken Sie den Empfnger in einen USB-Anschluss Ihres PCs.

1

USB-Dongle-Fach

Aus

Standard- modus

Spielemodus

Wenn Autorun NICHT aktiviert ist, durchsuchen Sie die Support-CD nach der Datei setup.exe. Doppelklicken Sie auf die Datei, um das Programm zu installieren.

D eu

ts ch

Klicken Sie auf Start > Alle Programme > ASUS Gaming Mouse GX810 > ASUS ROG Gaming Mouse GX810, um das Programm zu starten. Wenn die Abbildung unten

erscheint, stecken Sie Ihre ASUS GX810 Gaming-Maus an einen USB-Anschluss Ihres

Computers an und klicken Sie auf OK, um das Programm erneut zu starten.

Programm starten

Hauptmen

3

6

7

8

11

17 18

4 5

10 9

1 2

1516 14 1213

19

23 24

22

21

20

D eutsch

Element Beschreibung

1. Zeigt den momentan verwendeten Mausmodus an.

2. Zeigt den aktuellen Batteriezustand an.

3. Auswahl einer Funktion fr jede Taste / Aktion aus der Drop-Down-Liste. * Mehr Details darber finden Sie in der folgenden Tabelle.

4. Auswahl einer Auflsung aus der Liste. * Dieses Element ist nur im Spielemodus verfgbar.

5. Regler verschieben, um die Scroll-Geschindigkeit einzustellen.

6. Regler verschieben, um die Doppelklickgeschwindigkeit einzustellen.

7. Hier doppelklicken, um die aktuelle Doppelklickgeschwindigkeit zu testen.

8. Hier klicken, um die nderungen in das ausgewhlte Profil zu speichern.

9. Hier klicken, um das ausgewhlte Profil anzuwenden.

10. Hier klicken, um die nderungen zu verwerfen und das Fenster zu schlieen.

11. Hier klicken, um die nderungen zu speichern und das Fenster zu schlieen.

12. Hier klicken, um die letzen vorgenommenen Einstellungen wiederherzustellen.

13. Hier klicken, um die Mausempfindlichkeit einzustellen.

14. Markieren, um die nderung der Mausempfindlichkeit durch das Einstellen der Werte der X-Achse und/oder Y-Achse zu aktivieren/deaktivieren.

15. Hier klicken, um das Fenster fr die Makroeinstellungen aufzurufen. Siehe Seite 16 fr Details.

16. Hier klicken, um das Eigenschaftenfenster aufzurufen. Siehe Seite 17 fr Details.

17. Hier klicken, um ein neues Profil zu erstellen.

18. Hier klicken, um ein Profil von Ihren Computer zu importieren.

19. Hier klicken, um ein Profil zu Ihren Computer zu exportieren.

20. Zeigt die Abfragerate an.

21. Doppelklicken Sie auf den Profilnamen, um diesen zu ndern.

22. Der blau gepunktete Text neben dem Element zeigt das aktive Profil an.

23. Hier klicken, um das ausgewhlte Profil zu duplizieren.

24. Hier klicken, um das ausgewhlte Profil zu lschen. * Das aktive Profil kann nicht gelscht werden.

D eu

ts ch

Element Beschreibung

Linke Taste Taste verhlt sich wie die linke Maustaste

Rechte Taste Taste verhlt sich wie die rechte Maustaste

Scroll-Taste Bei dieser Auswahl aktiviert diese Taste die Standard-Bildlauffunktion.

DPI-Umschalter Bei dieser Auswahl whlt diese Taste die Abtastauflsung. * Diese Funktion ist nur im Spielemodus verfgbar.

Dauerfeuer Bei dieser Auswahl wird mit dieser Taste Wenn ausgewhlt wird mit dieser Taste in Klicken-zum-Angreifen-Spielen Dauerfeuer ausgelst, genau so wie beim dreifachen Drcken der linken Maustaste. Siehe Seite 18 fr Details.

Seite vor Bei dieser Auswahl wird zu einer schon angeschauten Seite vorgeblttert. Funktioniert wie das Drcken von .

Seite zurck Bei dieser Auswahl wird zu einer schon angeschauten Seite zurck geblttert. Funktioniert wie das Drcken von .

Macro Bei dieser Auswahl wird mit dieser Taste ein Befehl oder eine Reihe von Befehlen ausgefhrt, welche Sie im Makro-bearbeiten-Men einstellen knnen. Siehe Seite 19 fr mehr Details.

Programm starten Bei dieser Auswahl startet diese Taste das von Ihnen festgelegte Programm. Siehe Seite 20 fr mehr Details.

One-Touch- Einstellung

Bei dieser Auswahl startet diese Taste dieses Programm.

Mein Computer Bei dieser Auswahl wird mit dieser Taste das Mein Computer-Fenster geffnet.

Webbrowser Bei dieser Auswahl wird mit dieser Taste Ihr Standard-Webbrowser geffnet.

Mail-Programm Bei dieser Auswahl wird mit dieser Taste Ihre Standard-Email-Anwendung geffnet.

Bildlauf links/ rechts

Bei dieser Auswahl funktioniert die Taste als Bildlauf links/rechts, so wie es das Kippen des Mausrades ausfhren wrde. * Diese Funktion ist nur in Microsoft Office unter Windows 7 / Vista

verfgbar.

Ton aus Bei dieser Auswahl wird mit dieser Taste der Ton aus-/eingeschaltet.

Media Player/ Wiedergabe-Stopp

Bei dieser Auswahl wird mit dieser Taste Ihr Standard-Media-Player geffnet oder die Wiedergabe im aktiven Media-Player gestartet oder angehalten.

Anwendungs- umschalter

Bei dieser Auswahl schaltet die Taste zwischen den laufenden Anwendungen um. Funktioniert wie das Drcken von .

Flip-3D Bei dieser Auswahl schaltet die Taste mittels Flip 3D zwischen den Fenstern um. * Diese Funktion ist nur unter Windows 7 verfgbar.

D eutsch

Makro-Einstellungsmen

Elemente Beschreibung

1. Klicken, um die Aufnahme der Tastenanschlge und/oder Mausaktionen zu starten. und zu stoppen * Es knnen maximal 40 Tastenanschlge fr jedes Profil aufgenommen werden.

2. Hiermit werden alle Verzgerungen zwischen den Tastenanschlgen ignoriert.

3. Zeigt die aufgezeichneten Tastenanschlge und Verzgerungen an.

4. Verschiebt den gewhlten Tastananschlag oder Verzgerung nach oben/unten.

5. Fgt eine Verzgerung ein.

6. Whlt die gewnschte einzufgende Verzgerungszeit aus.

7. Wiederholungsmodus auswhlen.

Einmal pro Klick: Makroprofil wird einmal pro Mausklick ausgefhrt. Klick zum Wiederholen, nchster Klick zum Stoppen: Makroprofil wird beim

Mausklick gestartet und beim nchsten Klick angehalten. Klicken zum Wiederholen: Auswhlen, wie viele Durchlufe das Makroprofil pro

Mausklick durchfhren soll. Die Anzahl kann in der Liste ausgewhlt werden. Gedrckt halten fr Wiederholen: Auswhlen, um das Makroprofil so lange

auszufhren, bis die Maustaste wieder losgelassen wird.

8. Hier klicken, um die im ausgewhlten Profil vorgenommenen nderungen zu speichern.

5

7

8

11 10 9

1 2

12

13 14

3

4

6

continued on the next page

15

D eu

ts ch

Element Beschreibung

1. Markieren, um das ROG-Symbol in der Windows-Taskleiste anzuzeigen.

2. Markieren, um die Onscreen-Anzeigefunktion zu aktivieren.

3. Anklicken, um die vorgenommenen nderungen zu speichern und das Fenster zu schlieen.

4. Anklicken, um die vorgenommenen nderungen zu verwerfen und das Fenster zu schlieen.

Eigenschaftenmen

3 4

2 1

Element Beschreibung

9. Vorgenommene nderungen verwerfen und Fenster schlieen.

10. Vorgenommene nderungen speichern und Fenster schlieen.

11. Ausgewhltes Profil einer Maustaste zuordnen.

12. Neues Makroprofil erstellen.

13. Ausgewhltes Makroprofil lschen.

14. Ausgewhltes Makroprofil duplizieren.

15. Zum ndern des Makroprofilnamens hier doppelklicken.

D eutsch

Dauerfeuermen

2

4 3

1

Element Beschreibung

1. Hier klicken, um das Dauerfeuermen zu ffnen.

2. Hier klicken, um den Dauerfeuermodus auszuwhlen.

3-Geschosse-Modus: Feuert drei Geschosse pro Mausklick.

5-Geschosse-Modus: Feuert fnf Geschosse pro Mausklick.

Vollautomatischer Modus: Feuert bei Mausklick vollautomatisch in Dauerfeuer und stoppt beim nchsten Mausklick.

3. Anklicken, um die vorgenommenen nderungen zu speichern und das Fenster zu schlieen.

4. Anklicken, um die vorgenommenen nderungen zu verwerfen und das Fenster zu schlieen.

D eu

ts ch

Makro-Einstellungsmen

3

2

1

Element Beschreibung

1. Hier klicken, um das Makro-Einstellungsmen zu ffnen.

2. Hier klicken, um das ausgewhlte Profil einer Maustaste zuzuweisen.

3. Der blaue Punkt neben dem Element zeigt das aktive Makroprofil an.

100

D eutsch

Programmauswahlmen

Element Beschreibung

1. Hier klicken, um das Programmauswahlmen zu ffnen.

2. Geben Sie hier den Kurznamen des Programms ein, welches Sie beim Klicken der Maustaste ausfhren wollen.

3. Whlen Sie ein Programm aus, welches Sie beim Klicken der Maustaste ausfhren wollen.

4. Anklicken, um die vorgenommenen nderungen zu verwerfen und das Fenster zu schlieen.

5. Anklicken, um die vorgenommenen nderungen zu speichern und das Fenster zu schlieen.

2

3

1

5 4

101

D eu

ts ch

Taskleistenmen

1

3 2

4 5 6

Element Beschreibung

1. Das ROG-Logo erscheint in der Taskleiste, wenn das Programm richtig installiert ist.

2. Hier klicken, um das Hauptmen dieses Programms zu ffnen.

3. Hier klicken, um die offizielle ASUS-Webseite aufzurufen.

4. Hier klicken, um die Onscreen-Anzeigefunktion zu aktivieren/deaktivieren.

5. Hier klicken, um das Programm zu beenden.

6. Hier klicken, um die Programm- und Treiberversion zu berprfen.

10

D eutsch

Felhasznli.kziknyv

ASUS.GX810.ROG.lzeres.tkegr

04

M ayar

Szerzi.ogi.informcik

ASUSTeK.COMPUTER.INC. Vllalatcme 5ieadeitaieiaian5 ltalns(tel.) +886843447 ltalns(fax) +88680778 Email inf@ass.cm.t Webldal .ass.cm.t

Technical.Support ltalns(tel.) +86384 Onlinetmats srt.ass.cm

ASUS.COMPUTER.INTERNATIONAL.America Vllalatcme 800rrateWayFremntA453A ltalns(tel.) +50733777 ltalns(fax) +506084555 Webldal sa.ass.cm

Technical.Support ltalns(tel.) +88787 ltalns(fax) +8840883 Onlinetmats srt.ass.cm

ASUS.COMPUTER.GmbH.Nmetorszg,.Ausztria Vllalatcme arkrttr.340880atinenermany ltalns(fax) +405 Webldal .ass.de Onlinetmats .ass.de/sales

Mszaki.tmogats szeystelefnszm +4805003* endszer/Ntebk +4805000*

/Eee/telefnszm

ltalns(fax) +405 Onlinetmats srt.ass.cm

*04er/ercnmetrszivnalastelefnrl;04er/ercmbiltelefnrl.

05

M a

ya r

AzAX80Olzeresjtkercsmajnakazalbbitteleketkell tartalmaznia:

. ASUS.GX810.ROG.tkegr . Nano.US.2,4.GHz-es.vev . 3.x.AAA.elem . Gyors.zembe.helyezsi.tmutat . Tmogat.CD

Amennyibenattelekkzlbrmelyiksrltvayhinyzikljenkacslatbaa fralmazval.

A.csomag.tartalma

Mszaki.adatok.sszefoglalsa

Modell.nv X80

Szn Fekete

Vezetk.nlkli. technolgia

F4z

Opercis.rendszer. tmogats WindsX/WindsVista/Winds7

Mretek.mm Er:05()x66(W)x37() Weight Er:8(elemnlkl)

Gombok./.Kapcsolk

xBal mb /Jbbmb/retkerk xBalra/Jbbradnthetretkerk xOldalsmb xIkacsl(sakJtkmdban)/Alkalmazsvlt(sak

nrmlmdban) xKettsmdkacsl

Felbonts 800/600/000/300di(kizrlajtkmdbanllthat)* *Nrmlmdbanafelbnts00direrztett.AJtkmd

alartelmezettfelbntsa300di. emeneti.feszltsg .5V

Elrt.teleptpus 3dbAAAelem

Amszakiadatkelzetesrtestsnlklmevltzhatnak..

06

M ayar

Az.ASUS.GX810.ROG.lzeres.tkegr.ismertetse

AznAX80Ojtkeerebalilletvejbbmbbalretkerkkel ktldalsmbbalIvltmbbalseyklnleeskialaktsKettsmd kacslvalrendelkezik.

1 Balmb

2 Jbbmb

3 retkerk / nthet kerk / felbntskijelz*

4 I kacsl (sak Jtk mdban) Alkalmazs vlt (sak nrml

mdban) 5 Erfedl 6 Oemblma 7 Oldalsmb 8 sszstlmikialakts 9 Ertart 10 zerrzkel 11 Kettsmdkacsl** 12 Bklcstart 13 NanB4zesvev

llapot Kielzsek Eyszerfelvillan 800di

Ktszerfelvillan 600di

rmszrfelvillan 000di

Nyszerfelvillan 300di

*. Felbonts.kielz

Ikonok Kielzsek Kikacsltllat

Nrmlmd

Jtkmd

**. .Ketts.md.kapcsol

23 4

5

6 7

8

7

1

9

12 9

11 9

13

10

07

M a

ya r

Az.elem.beszerelse

Amellkeltelemeknemjratlthetek. ahsszabbideinemhasznljaazeerettvltsaelazelemeket. jvayhasnltselemekethasznljn. MivelX80eeremreyetlenelemmelismkdikazerslyteyvaykt

elemeltvltsvalilletvehzzadsvalmdsthatja. aazeeretbekacsljasazelemekkimerlflbenvannakanarancssra

E(retkerk)eyercivillnifmajdaznnalkialszikhamzatjaaz eeretvaykattintazeyikmbbal.

1 2 3

. Keressemeafedltetejnlvbevst.elyezzehvelykjjtabevsfl majdemeljefelafedeletazeltvltshz.

. Amefelellaritsjelzsszerinthelyezzenlefeljebbhrmelemeta nylskba.

3. Afedlvisszahelyezsheztljaanyllaljelzettirnyba.

08

M ayar

Az.ASUS.GX810.ROG.tkegr.szemlyre.szabsa

Ahzzadtttmattartalmazeysecilisankifejlesztettrramtmely lehetvtesziaX80kszlketlajdnsainakmaximliskihasznlst.eyea tmattaztikaimehajtbaskvesseakernynlthattastskata rramelindtshz.

AmennyibenNEMenedlyeztkazatmatikslejtszstaznszmtn keressemeasetup.exefjltatmatn.Arramteletshez kattintsndlnafjlra.

Azerszemlyreszabsvalkacslatsrszletestastskrtfrdljna tmatnmellkeltfelhasznlikziknyvhz.

PC-hez.csatlakoz

2

AzBvevkszlketazerbelsejbenlehettrlni. Az eneriatakarkss rdekben kacslja ki a telltst amikr nem hasznl

jaazeeret.

. VeyekiazBvevtazBrekeszbl majdlltsaazzemkacslttandard (Nrml)mdranrmlhasznlathz illetveamin(Jtk)mdraajbb jtkteljestmnyrdekben.

. IllesszebeazBvevtey rendelkezsrellBrtba.

1

US.kulcstart

Ki

Norml. mdban

Jtk.mdban

0

M a

ya r

KattintsnaStart>All.Programs.Minden.program>ASUS.Gaming.Mouse. GX810.ASUS.tkegr.GX810.>.ASUS.ROG.Gaming.Mouse.GX810.ASUS.ROG. tkegr.GX810elemrearramindtshz. Mejelenikazalbbikerny.satlakztassaazAX80jtkeereta szmtBcsatlakzjhzmajdkattintsnazOKmbraarram jraindtshz.

A.Program.indtsa

Fmen

3

6 7

8

11

17 18

4 5

10 9

1 2

1516 14 1213

19

23 24

22

21

20

0

M ayar

Funkcik Lers

1. Azenhasznlatbanlverzemmdtmtatja.

2. Azakkmltraktlisszintjtmtatja.

3. Alerdllistrlvlasszneyfnkcit/mveletetazeyesmbkszmra. *vbbirszletekrtlsdakvetkezldalnlvtblzatt.

4. Vlasszneyfelbntstalerdllistrl. *Ezazelemkizrlajtkmdbanllthatbe.

5. asznljaacsszktaretsisebessbelltshz.

6. asznljaacsszktadlakattintssebessnekbelltshz.

7. Kattintsnktszeraziknraadlakattintsaktlissebessnekellenrzshez.

8. Kattintsnambraakivlasztttrfilnvzettmdstskmentshez.

9. Kattintsnambraakivlasztttrfilalkalmazshz.

10. Kattintsnambraamdstskelvetshezsakernybezrshz.

11. Kattintsnambraamdstskmentshezsakernybezrshz.

12. Kattintsnambraaletbbibelltskvisszalltshz.

13. Kattintsnambraazerrzkenysnekbelltshz.

14. JelljebeamefelelnyzetetazerrzkenysXtenelys/vayYtenely rtkbelltsnkeresztltrtnmdstsnakenedlyezshezvayletiltshz.

15. KattintsnambraaMacrettins(Makrbelltsk)ablakmenyitshz.sd 6. ldaltvbbirszletekrt.

16. Kattintsnambraareferences(referencik)ablakmenyitshz.sd 7. ldal tvbbirszletekrt.

17. Kattintsnambrajrfilltrehzshz.

18. Kattintsnambrarfilimrtlshzaszmtrl.

19. Kattintsnambrarfilexrtlshzaszmtre.

20. Alekrdezsisebessetmtatja.

21. Kattintsnktszerarfilnvreamdstshz.

22. Azelemmellettikkntazaktvrfiltjelli.

23. Kattintsnambraakivlasztttrfildliklshz.

24. Kattintsnambraakivlasztttrfiltrlshez. *Azaktvrfilnemtrlhet.

M a

ya r

Funkcik Lers al.gomb Ahaymnysbalermbmkdsttnzza.

Jobb.gomb Ahaymnysjbbermbmkdsttnzza.

Grget.gomb akijellteazelemetnymjameambtahaymnysrets fnkcivrehajtshz.

DPI.vlts akijellteazelemetnymjameambteyerfelbnts kivlasztshz. *Ezalehetskizrlajtkmdbanjelenikme.

Sorozattz akijellteazelemetnymjameambtsrzatlvshezey lvldzsjtkban.Afnkcimeeyezikabalermbtrila kattintsval.Arszleteketlsda8.ldaln.

Lapozs.elre akijellteazelemetnymjameambtakvetkezmetekintett ldalralshez.Afnkcimeeyezikaz mb menymsval.

Lapozs.vissza akijellteazelemetnymjameambtazelzlemetekintettldalra lshez.Afnkcimeeyezikaz mbmenymsval.

Makr akijellteazelemetnymjameambteyarancsvayarancs srzataktivlshzamelyeketaMacrrfileManaement(Makr rfilkezels)menbenszerkeszthet.sd . ldal tvbbi rszletekrt.

Program.indtsa akijellteazelemetnymjameambtameadttrram indtshz.sd 0. ldal tvbbi rszletekrt.

Egyrintses.bellts akijellteazelemetnymjameambtarramindtshz.

Sat.Gp Amikrkivlasztjanymjameambtaajtablak menyitshz.

Webbngsz Amikrkivlasztjanymjameambtazalartelmezetteb bnszelindtshz.

E-mail.Kliens Amikrkivlasztjanymjameambtazalartelmezettlevelez rendszerelindtshz.

Grgets.balra./. Jobbra

akijellteazelemetnymjameambthyadnthetkerkhez hasnlanbalra/jbbraressen. *EzafnkcicsakMicrsftOfficealkalmazskkalmkdikWinds7/ Vistaercisrendszeralatt.

Elnmts Amikrkivlasztjanymjameambtahanerelnmtsnakbe/ki kacslshz.

Mdia.Letsz/ Jtk/sznet

akijellteazelemetnymjameambtazalartelmezett mdialejtszindtshzilletvealejtszsindtshz/szneteltetshez aktvmdialejtszmellett.

tvlts. alkalmazsok.kztt

akijellteazelemetnymjameambtaftalkalmazskkztti vltshz.Afnkcimeeyezikaz mbmenymsval.

3D.lapozs akijellteazelemetnymjameambtazablakkkzttivltshza 3lazsfnkcisetsvel. *EzafnkcicsakWinds7alattmkdik.

M ayar

Makr-belltsok.men

Funkcik Lers

1. Kattintsnambraambnymskrztshezmajdkattintsnrjraarzts lelltshz. *rfilnkntlefeljebb40mbnymsrzthet.

2. Jelljebeambnymskkzttiidksleltetsfiyelmenkvlhayshz.

3. Arztettmbnymskatsidksleltetstmtatjarztskzben.

4. Kattintsnambraakijelltmbnymskvayksleltetsfelfel/lefel mzatshz.

5. Kattintsnreyksleltetsbeilesztshez.

6. Kattintsnrabeszrandksleltetskivlasztshz.

7. kattintsnrazismtlsimdkivlasztshz. Kattintsonknt.egyszer:jelljekiamakrrfileyszerivrehajtshzamikraz

ermbrakattint. Kattintsra.ismtls,.kvetkez.kattintsra.lell:jelljekiamakrrfilismtlshez

amikrazermbrakattintsannaklelltshzeyjabbkattintsra. Kattintsra.ismtls:jelljekihnyszrkvnjameismtelniamakrrfil

vrehajtstamikrazermbrakattint.Alerdllistrlvlasszakihnyszr kvnjameismtelni.

Nyoma.meg.az.ismtlshez:jelljekiamakrrfilismtlshezamikraz ermbtlenymvatartjasannaklelltshzambelenedsekr.

8. Kattintsnambraakivlasztttrfilnvzettmdstskmentshez.

5

7

8

11 10 9

1 2

12

13 14

3

4

6

folytats a kvetkez oldalon

15

3

M a

ya r

Funkcik Lers

1. JelljebeanyzetethymejelentseazOikntaWindsrtestsiterletn.

2. Jelljebeakernyntrtnkijelzsfnkcienedlyezshez.

3. Kattintsnambraamdstskmentshezsakernybezrshz.

4. Kattintsnambraamdstskelvetshezsakernybezrshz.

Preferencik men.

3 4

2 1

Funkcik Lers 9. Kattintsnambraamdstskelvetshezsakernybezrshz.

10. Kattintsnambraamdstskmentshezsakernybezrshz.

11. Kattintsnambraakijelltrfilermbhztrtnrendelshez.

12. Kattintsnambrajmakrrfilltrehzshz.

13. Kattintsnambraakivlasztttmakrrfiltrlshez.

14. Kattintsnambraakivlasztttmakrrfildliklshz.

15. Kattintsnktszerarfilnvreamdstshz.

4

M ayar

Sorozattz.men

Funkcik Lers

1. KattintsnambraaBrstFire(rzattz)menindtshz.

2. Kattintsnambraasrzattzmdkivlasztshz. 3.Lvedk.md:.Jelljekihyeymbkattintsrahrmatljn. 5.Lvedk.md:.Jelljekihyeymbkattintsrattljn. Telesen.automata.md:.jelljekiateljesenatmatalvshezamikraz

ermbrakattintsannaklelltshzeyjabbkattintsra.

3. Kattintsnambraamdstskmentshezsakernybezrshz.

4. Kattintsnambraamdstskelvetshezsakernybezrshz.

2

4 3

1

5

M a

ya r

Makr-belltsok.men

Funkcik Lers

1. KattintsnambraaMacrettins(Makrbelltsk)menindtshz.

2. Kattintsnambraakijelltrfilermbhztrtnrendelshez.

3. Azelemmellettikkntazaktvmakrrfiltjelli.

3

2

1

6

M ayar

Programvlaszt.men

Funkcik Lers

1. Kattintsnambraarramelectin(rramvlaszt)menindtshz.

2. eljebeaznrramarancsiknjnaknevtamelyetazermbrakattintva elakarindtani.

3. Vlasszakiaztarramtamelyetazermbrakattintvafttatniakar.

4. Kattintsnambraamdstskmentshezsakernybezrshz.

5. Kattintsnambraamdstskmentshezsakernybezrshz.

2

3

1

5 4

7

M a

ya r

Feladatsor.men

Funkcik Lers

1. AzOemblmamejelenikafeladatsrnhaarramtmefelelen teletettk.

2. Kattintsnambraarramfmenjnekindtshz.

3. KattintsnrazAhivatalsebhelyretrtnrshz.

4. Kattintsnambraakernyntrtnkijelzsfnkcienedlyezshez/ letiltshz.

5. Kattintsnambraarrambltrtnkilshez.

6. Kattintsnambraazalkalmazssillesztrramverzijnakellenrzshez.

1

3 2

4 5 6

8

M ayar

Manuale Utente

ASUS GX810 ROG Gaming Mouse

10

Italiano

Le condizioni di garanzia variano a seconda del tipo di prodotto e sono specificatamente indicate nel Certificato di Garanzia allegato, cui si fa espresso rinvio.

Inoltre la presente garanzia non valida in caso di danni o difetti dovuti ai seguenti fattori: (a) uso non idoneo, funzionamento o manutenzione improprio, incluso senza limitazioni lutilizzo del prodotto con una finalit diversa da quella conforme alle istruzioni di ASUSTeK COMPUTER INC. in merito allidoneit di utilizzo e alla manutenzione; (b) installazione o utilizzo del prodotto in modo non conforme aglli standard tecnici o di sicurezza vigenti nell Area Economica Europea e in Svizzera; (c) collegamento a rete di alimentazione con tensione non corretta; (d) utilizzo del prodotto con accessori di terzi, prodotti o dispositivi ausiliari o periferiche; (e) tentativo di riparazione effettuato da una qualunque terza parte diversa dai centri di assistenza ASUSTeK COMPUTER INC. autorizzati; (f ) incidenti,fulmini,acqua, incendio o qualsiasi altra causa il cui controllo non dipende da ASUSTeK COMPUTER INC.; abuso, negligenza o uso commerciale.

La presente Garanzia non valida per lassistenza tecnica o il supporto per l utilizzo del prodotto, compreso lutilizzo dell hardware o del software. Lassistenza e il supporto disponibili (se previsti), nonch le spese e gli altri termini relativi all assistenza e al supporto (se previsti) verranno specificati nella documentazione destinata al cliente fornita a corredo con il Prodotto.

E responsabilit dellutente, prima ancora di richiedere lassistenza, effettuare il backup dei contenuti presenti sul Prodotto, inclusi i dati archiviati o il software installato nel prodotto. ASUSTeK COMPUTER INC. non in alcun modo responsabile per qualsiasi danno, perdita di programmi, dati o altre informazioni archiviate su qualsiasi supporto o parte del prodotto per il quale viene richiesta lassistenza; ASUSTeK COMPUTER INC.non in alcun modo responsabile delle conseguenze di tali danni o perdite, incluse quelle di attivit, in caso di malfunzionamento di sistema, errori di programmi o perdita di dati.

E responsabilit dellutente, prima ancora di richiedere lassistenza, eliminare eventuali funzioni, componenti, opzioni, modifiche e allegati non coperti dalla presente Garanzia, prima di far pervenire il prodotto a un centro servizi ASUSTeK COMPUTER INC. ASUSTeK COMPUTER INC. non in alcun modo responsabile di qualsiasi perdita o danno ai componenti sopra descritti.

ASUSTeK COMPUTER INC. non in alcun modo responsabile di eliminazioni, modifiche o alterazioni ai contenuti presenti sul Prodotto compresi eventuali dati o applicazioni prodottesi durante le procedure di riparazione del Prodotto stesso. Il Prodotto verr restituito allutente con la configurazione originale di vendita, in base alle disponibilit di software a magazzino.

Condizioni e Limiti di Copertura della Garanzia sul Prodotto

Ita lia

no

11

I prodotti ASUS possono essere corredati da software, secondo la tipologia del prodotto.I software, abbinati ai prodotti, sono in versione OEM: Il software OEM viene concesso in licenza allutente finale, come parte integrante del prodotto; ci significa che non pu essere trasferito ad altri sistemi hardware e che, in caso di rottura, di furto o in ogni altra situazione che lo renda inutilizzabile, anche la possibilit di utilizzare il prodotto OEM viene compromessa.

Chiunque acquisti, unitamente al prodotto, un software OEM, tenuto ad osservare i termini e le condizioni del contratto di licenza tra il proprietario del software e lutente finale, denominato EULA (End User Licence Agreement), visualizzato a video, durante la fase di installazione del software stesso. Si avvisa che laccettazione, da parte dell utente, delle condizioni dell EULA, ha luogo al momento dell installazione del software stesso.

Licenza Software

1

Italiano

Contatti ASUS

ASUSTeK COMPUTER INC. Indirizzo 15 Li-Te Road, Peitou, Taipei, Taiwan 11259 Telefono +886-2-2894-3447 Fax +886-2-2890-7798 E-mail info@asus.com.tw Sito web www.asus.com.tw

Supporto Tecnico Telefono +86-21-38429911 Supporto Online support.asus.com

ASUS COMPUTER INTERNATIONAL (America) Indirizzo 800 Corporate Way, Fremont, CA 94539, USA Telefono +1-510-739-3777 Fax +1-510-608-4555 Sito web usa.asus.com

Supporto Tecnico Telefono +1-812-282-2787 Fax Supporto +1-812-284-0883 Supporto Online support.asus.com

ASUSTeK ITALY S.r.l (Italia) Indirizzo Strada Statale Padana Superiore, 28 20063 Cernusco sul Naviglio (MI)

Supporto Tecnico Telefono Notebook/Eee 199 400 089* Telefono Altri Prodotti 199 400 059* Sito web www.asus.it

*Per chiamare da reti fisse Telecom Italia e Colt, il costo di 0,12 euro al minuto iva inclusa e la durata massima della telefonata non dovr essere superiore a 120 minuti; per le chiamate da cellulare, il costo dipende dal vostro operatore d'accesso.

Ita lia

no

1

Controllare che nella confezione di ASUS GX810 ROG Gaming Mouse siano contenuti

i seguenti articoli:

ASUS GX810 ROG Gaming Mouse

Ricevitore Nano USB 2.4 GHz

3 x batterie AAA

Guida Rapida

CD di Supporto

In caso di articoli danneggiati o mancanti, contattare subito il rivenditore.

Contenuto della Confezione

Specifiche Tecniche

Nome del Modello GX810

Colore Nero

Tecnologia Wireless RF 2.4GHz

Supporto OS Windows XP / Windows Vista / Windows 7

Dimensioni (mm) Mouse: 105(L) x 66(W) x 37(H)

Peso Mouse: 82g (senza batterie)

Tasti / Interruttori

1 x Tasto Sinistro / Tasto Destro / Rotellina di Scorrimento 1 x Rotellina di Scorrimento omnidirezionale 2 x Tasti Laterali 1 x Tasto DPI (solo in modalit di gioco) / cambio applicazione

(solo in modalit standard) 1 x Convertitore di modalit

Risoluzione 800 / 1600 / 2000 / 3200 dpi (regolabile solo in modalit di gioco)* * In modalit Standard, la risoluzione impostata su 1200dpi. La

risoluzione predefinita in modalit di gioco 3200dpi.

Voltaggio in ingresso 1.5V

Requisiti Batteria 1 a 3 batterie AAA

Le specifiche sono soggette a variazioni senza obbligo di preavviso.

1

Italiano

Descrizione di ASUS GX810 ROG Gaming Mouse

ASUS GX810 ROG Gaming Mouse dotato di un tasto sinistro, un tasto destro,una

rotellina di scorrimento, due tasti laterali, un tasto dedicato DPI ed uno speciale

pulsante per il cambio di modalit.

1 Tasto sinistro

2 Tasto destro

3 Rotellina di scorrimento omnidirezionale / Indicatore risoluzione*

4 Tasto DPI (solo in mod. di gioco) Cambio applicazione (solo in mod.

standard)

5 Copertura del mouse

6 Logo ROG

7 Tasti laterali

8 Supporto laterale in gomma antiscivolo

9 Piedini del mouse

10 Sensore laser

11 Convertitore di modalit**

12 Scomparto per dongle USB

13 Ricevitore Nano USB 2.4 GHz

Stato Indicazioni

Un lampeggio 800 dpi

Due lampeggi 1600 dpi

Tre lampeggi 2000 dpi

Quattro lampeggi 3200 dpi

* Indicatore di Risoluzione

Icone Indicazioni

Spento

Mod. Standard

Modalit di Gioco

** Convertitore di modalit

23 4

5

6 7

8

7

1

9

12 9

11 9

13

10

Ita lia

no

1

Installazione delle Batterie

Le batterie in dotazione non sono ricaricabili. Se non si utilizza il mouse per lungo tempo, rimuovere le batterie. Utilizzare batterie nuove o o di tipo simile. Dato che il mouse GX810 funziona con una sola batteria, possibile regolare il peso del mouse mediante laggiunta o la rimozione di una o due batterie. Quando il mouse acceso con le batterie scariche, la spia LED di colore arancione

(rotellina di scorrimento) inizia a lampeggiare per un minuto, per poi spegnersi immediatamente con un movimento del mouse o un clic su un tasto.

1 2 3

1. Individuare la tacca sullestremit superiore della copertura. Porre il pollice sulla tacca e poi sollevare la copertura per rimuoverla.

2. Inserire negli appositi scomparti sino a tre batterie, prestando attenzione alla corretta polarit.

3. Per rimontare la copertura, inserirla seguendo la direzione delle frecce.

1

Italiano Personalizzazione di ASUS GX810 ROG Gaming Mouse

Nel CD di supporto, in dotazione con il prodotto, contenuto uno speciale programma di

personalizzazione del mouse, che consente di utilizzare tutte le sue funzionalit. Inserire

il CD di supporto nellunit ottica e seguire le istruzioni sullo schermo per installare il

programma.

Se nel computer NON attivata la funzione di esecuzione automatica, sfogliare il contenuto del CD di supporto per individuare il file setup.exe file. Cliccarvi due volte per installare il programma.

Connessione con il PC

2

Conservare il ricevitore USB allinterno del mouse. Per risparmiare energia, spegnere il mouse quando non utilizzato.

1. Rimuovere il ricevitore USB dall'apposito scomparto e impostare il pulsante di accensione in modalit Standard per l'uso normale o in modalit di gioco per migliorare le prestazioni con i videogiochi.

2. Inserire il ricevitore USB in una porta USB libera.

1

Scomparto dongle USB

Disattivo

Mod. Standard

Mod. di gioco

Ita lia

no

1

Cliccare Start > All Programs > ASUS Gaming Mouse GX810 > ASUS ROG Gaming Mouse GX810 per avviare il programma.

Se appare la schermata sottostante, inserire ASUS GX810 Gaming Mouse nella porta

USB del computer, quindi cliccare OK per riavviare il programma.

Avvio del Programma

Menu Principale

3

6

7

8

11

17 18

4 5

10 9

1 2

1516 14 1213

19

23 24

22

21

20

1

Italiano

Elemento Descrizione

1. Visualizza la modalit in uso.

2. Visualizza il livello della batteria.

3. Selezionare una funzione per ciascun pulsante / azione dallelenco a discesa. * Per i dettagli, consultare la tabella alla pagina seguente.

4. Selezionare la risoluzione dallelenco a discesa. * Qusto elemento configurabile soltanto in modalit di gioco.

5. Trascinare il cursore per regolare la velocit di scorrimento.

6. Trascinare il cursore per regolare la velocit del doppio clic.

7. Cliccare due volte su questa icona per testare la velocit del doppio clic.

8. Cliccare per salvare le modifiche apportate al profilo selezionato.

9. Cliccare su questo pulsante per applicare il profilo selezionato.

10. Cliccare su questo pulsante per annullare le modifiche applicate e chiudere la schermata.

11. Cliccare su questo pulsante per salvare le modifiche e uscire.

12. Cliccare su questo pulsante per ripristinare le impostazioni pi recenti.

13. Scorrere il cursore per regolare la sensibilit del mouse.

14. Selezionare questa casella per attivare lopzione di variazione della sensibilit del mouse tramte regolazione dei valori dellasse X e/o dellasse Y.

15. Cliccare su questo pulsante per visualizzare la finestra con le impostazioni Macro. Per i dettagli, vedere a pagina 16.

16. Cliccare su questo pulsante per visualizzare la finestra Preferences(Preferenze). Per i dettagli, vedere a pagina 17.

17. Cliccare su questo pulsante per creare un nuovo profilo.

18. Cliccare su questo pulsante per importare un profilo dal computer.

19. Cliccare su questo pulsante per esportare un profilo verso il computer.

20. Visualizza la frequenza di polling.

21. Cliccare due volte sul nome del profilo da modificare.

22. La spia blu accesa segnala lattivazione del profilo.

23. Cliccare su questa icona per duplicare il profilo selezionato.

24. Cliccare su questa icona per eliminare il profilo selezionato. * Non possibile eliminare un profilo quando attivo.

Ita lia

no

1

Elemento Descrizione

Pulsante sinistro Riproduce la funzione del tasto sinistro del mouse.

Pulsante destro Riproduce la funzione del tasto destro del mouse.

Pulsante scorrim. Pulsante per eseguire la funzione di scorrimento.

Pulsante DPI Pulsante per selezionare la risoluzione del mouse. * Questa opzione disponibile soltanto in modalit di gioco.

Burst Fire Pulsante per fare fuoco in un gioco di attacco, equivalente a cliccare al triplo clic con il tasto di sinistra del mouse. Per i dettagli, consultare pag.18

Pagina Avanti Pulsante per passare alla pagina successiva (funzione equivalente alla pressione dei tasti ).

Pagina Indietro Pulsante per visualizzare la pagina precedente (funzione equivalente alla pressione dei tasti ).

Macro Pulsante per eseguire un comando o una serie di comandi, editabili tramite il menu di gestione del profilo Macro.Vedere pag.19 per i dettagli.

Avvio Programma Pulsante di avvio del programma specificato.Vedere pag.20 per i dettagli.

One Touch Setting Pulsante di avvio del programma.

Risorse Computer Pulsante per lapertura della finestra Risorse del Computer.

Web Browser Pulsante di avvio del browser web predefinito.

Client E-Mail Pulsante di avvio dellapplicazione di posta elettronica predefinita.

Scorrimento Sinistra / Destra

Pulsante di scorrimento a destra / sinistra. * Funzione disponibile soltanto in applicazioni Microsoft Office con i

sistemi operativi Windows 7 / Vista.

Silenziamento Pulsante per lattivazione/disattivazione del volume.

Media Player/ PlayPause

Pulsante di avvio del lettore multimediale predefinito o di esecuzione /sospensione di una riproduzione.

Cambio Applicazione

Pulsante per spostarsi fra le applicazioni in esecuzione, equivalente alla pressione dei tasti .

Flip-3D Pulsante per spostarsi fra le finestre tramite Flip 3D. * Funzione disponibile soltanto con il sistema operativo Windows 7.

10

Italiano

Memu Impostazioni Macro

Elemento Descrizione

1. Cliccare per avviare la registrazione dei tasti digitati (comandi). Cliccare di nuovo per terminare la registrazione. * E possibile registrare max. 40 tasti (comandi) per ciascun profilo.

2. La selezione della casella consente di eliminare il ritardo fra la pressione dei tasti.

3. Visualizzazione dei tasti registrati (pressione e rilascio) e dei relativi ritardi.

4. Pulsanti per modificare la successione dei tasti registrati e dei rispettivi ritardi.

5. Impostazione azione ritardata.

6. Selezione dellintervallo di tempo prescelto fra la pressione e il rilascio di un tasto.

7. Opzioni di ripetizione: Once per click: Selezionare questa opzione per eseguire un profilo macro alla

pressione di un tasto del mouse. Click to repeat, next click to stop: Selezionare questa opzione per ripetere

lesecuzione di un profilo macro alla pressione di un tasto del mouse. Premere di nuovo per interrompere loperazione.

Click to repeat: consente di selezionare dallelenco a discesa il numero di ripetizioni del profilo macro, da effettuare alla pressione di un tasto del mouse.

Pressed to repeat: Selezionare questa opzione per ripetere lesecuzione di un profilo macro tenendo premuto un tasto del mouse. Al termine, rilasciare il tasto.

8. Premere questo pulsante per salvare le modifiche al profilo selezionato.

5

7

8

11 10 9

1 2

12

13 14

3

4

6

continua alla pagina seguente

15

Ita lia

no

11

Elemento Descrizione

1. Selezionare questa casella per visualizzare licona ROG nellarea di notifica di Windows.

2. Selezionare questa casella per attivare la funzione OSD (On-Screen-Display).

3. Premere questo pulsante per salvare le modifiche e chiudere la finestra.

4. Premere questo pulsante per annullare le modifiche e chiudere la finestra.

Menu Preferenze

3 4

2 1

Elemento Descrizione

9. Annullamento delle modifiche e chiusura schermata.

10. Salvataggio delle modifiche e chiusura schermata.

11. Assegnazione di un profilo ad un tasto del mouse.

12. Creazione di un nuovo profilo macro.

13. Eliminazione del profilo macro selezionato.

14. Duplicazione del profilo macro selezionato.

15. Fare doppio clic sul profilo macro di cui modificare il nome.

1

Italiano

Menu Burst Fire

Elemento Descrizione

1. Cliccare qui per avviare il menu Burst Fire.

2. Selezionare una delle modalit Burst Fire: 3 Rounds Mode: Sparare tre volte alla pressione del tasto del mouse. 5 Rounds Mode: Sparare cinque volte alla pressione del tasto del mouse. Full Automatic Mode: modalit di fuoco automatico alla pressione del tasto del

mouse. Cliccare di nuovo per interrompere lazione.

3. Salvataggio delle modifiche e chiusura della finestra.

4. Annullamento modifiche e chiusura della finestra.

2

4 3

1

Ita lia

no

1

Menu Impostazioni Macro

Elemento Descrizione

1. Avvia il menu Impostazioni Macro.

2. Pulsante per assegnare il profilo selezionato a un tasto del mouse.

3. La spia blu accesa segnala lattivazione del profilo macro.

3

2

1

1

Italiano

Menu Selezione Programma

Elemento Descrizione

1. Avvio del menu di selezione programma.

2. Inserire il nome del collegamento rapido del programma da eseguire alla pressione di un tasto del mouse.

3. Selezionare il programma da eseguire alla pressione di un tasto del mouse.

4. Salvataggio delle modifiche e chiusura della pagina.

5. Annullamento modifiche e chiusura della pagina.

2

3

1

5 4

Ita lia

no

1

Menu sulla Barra delle Applicazioni

1

3 2

4 5 6

Elemento Descrizione

1. Nella barra delle applicazioni appare il logo ROG del programma installato.

2. Avvia il menu principale del programma.

3. Accede al sito ufficiale ASUS.

4. Attiva/ disattiva la funzione OSD (On-Screen-Display).

5. Chiude il programma.

6. Fornisce informazioni sulla versione di applicazioni e driver.

1

Italiano

Podrcznik.uytkownika

Laserowa.myszka.dla.graczy.ASUS. GX810.ROG

38

lski

Informace.kontaktowe.producenta

ASUSTeK.COMPUTER.INC..Asia.Pacific Adres 5ieadeitaieiaian5 elefn +886843447 Faks +88680778 Email inf@ass.cm.t trnainterneta .ass.cm.t

Pomoc.techniczna elefn +86384 Wsarcienline srt.ass.cm

ASUS.COMPUTER.INTERNATIONAL.Ameryka Adres 800rrateWayFremntA453A elefn +50733777 Faks +506084555 trnainterneta sa.ass.cm

Pomoc.techniczna elefn +88787 Fax(sarcie) +8840883 Wsarcienline srt.ass.cm

ASUS.COMPUTER.GmbH.Niemcy.&.Austria Adres arkrttr.340880atinenermany Faks +405 trnainterneta .ass.de Kntaktnline .ass.de/sales

Pomoc.techniczna elefn(dzes) +4805003* elefn(ystem/Ntebk/Eee/) +4805000* Fax(sarcie) +405 Wsarcienline srt.ass.cm

*E04/minzNiemiecztelefnstacjnarne;E04/minztelefnkmrke.

3

lsk

i

rsimysradziczyakanilaserejmyszkidlaraczyAX80O znajdjsinastjceelementy:

. Mysz.dla.graczy.ASUS.GX810.ROG . Odbiornik.Nano.US.2.4.GHz . 3.baterie.AAA . Przewodnik.szybkiego.startu . Pyta.CD.z.oprogramowaniem

Wrzyadkszkdzenialbbrakktrezelementskntaktjsi niezczniezesrzedac.

Zawarto.opakowania

Podstawowe.dane.techniczne

Nazwa.modelu X80

Kolor zarny

Technologia. bezprzewodowa

zsttliradia4z

Obsugiwane.systemy. operacyne WindsX/WindsVista/Winds7

Wymiary.mm Myszka:()x8(W)x43() Masa Myszka:8(bezbaterii)

Przyciski./.Przeczniki

xey rzycisk/ ray rzycisk /Kkrzeijania xee/raekrtchylania xrzyciskibczne xrzecznikrzdzielczci(tylktrybracza)/rzecznik

alikacji(tylktrybstandardy) xrzeczniktrybdjne

Rozdzielczo 800/600/000/300di(relacjatylktrybieracza)* *Wtrybiestandardymrzdzielczstainajestna

00di.mylnarzdzielcztrybraczat300di. Napicie.zasilania .5V Wymagania.dotyczce. baterii

d3bateriiAAA

radzmiancharakterystykibezrzedzeniazastrzene.

40

lski

Zapoznanie.z.laserow.myszk.dla.graczy.ASUS.GX810.ROG

MyszkadlaraczyAX80Oysanajestleyrzyciskrayrzycisk krtdrzeijaniadarzyciskibcznerzecznikrzdzielczciraz secjalniezarjektanyrzeczniktrybdjne.

1 eyrzycisk

2 rayrzycisk

3 Kkrzeijania/krtchylenia/ skanikrzdzielczci*

4

rzecznikrzdzielczci(tylktryb racza) rzecznik alikacji (tylk tryb

standardy) 5 kryamyszy 6 O 7 rzyciskibczne

8 Knstrkcjazmymielementami antylizymi

9 tkamyszy 10 zjniklasera 11 rzeczniktrybdjne** 12 rzedziaklczasrzteB 13 OdbirnikNanB.4z

Stan Znaczenie Jednminicie 800di

aminicia 600di

rzyminicia 000di

zteryminicia 300di

*. wskanik.rozdzielczoci

Ikony Znaczenie Wyczna

rybstandardy

rybracza

**. przecznik.trybu.podwnego

23 4

5

6 7

8

7

1

9

12 9

11 9

13

10

4

lsk

i

Monta/wymiana.baterii

cznebaterienienadajsidadania. Jeeliniebdzieszyamyszkirzezdszyczasyjmijbaterie. Zastsjnebaterielbbateriedbnety. nieamyszX80meracatylknajednejbateriimnarela masmyszkirzezddanielbsniciejednejlbdchbaterii. Wrzyadkczeniazasilaniamyszyrzyniskimstanienaadaniabaterii rzezjednmintbdziemiamaraczadida(krtrzeijania) ktrayczysinatychmiastrszenimyszklbkliknicirzyciskiem.

1 2 3

. Odnalenacicieblirnekcakryy.staikciknad nacicieminastniedniekrydryceljejsnicia.

. Wytrzybateriedtrzracajcanabien.

3. Wcelzaeniakryybateriinaleyjnacisnkiernkzaznacznym strzak.

4

lski

Dostosowani.myszy.dla.graczy.ASUS.GX810.ROG

starcznyakanimcniczydyskzaierasecjalnyrramktry mliiayknaniestaieX80celdstnieniajeszystkichfnkcji. Wmcniczydyskdnadtyczneiyknajinstrkcjeekrane celrchmieniarram.

JeelicjaAtrn(Atdtarzanie)NIEjestcznanakmterze rzejrzezaartytyzesternikamiabyzlkalizaliksetup.exe. krtniekliknlikcelzainstalaniarram.

zczeeinstrkcjedtyczcedstsaniamyszyatrzinstrkcja ytknikanayciezrramaniem.

Podczanie.do.komputera

2

MeszrzechyadbirnikBentrzmyszy. Abyzaszczdzieneriyczzasilaniekiedyniekrzystaszzmyszy.

. WyjcdbirnikBzrzedziaB istaicznikzasilanianatryb standardydzykeytkania lbnatrybraczaabyzyskalesze charakterystykiczasiery.

. WdbirnikBd lnertB.

1

Przedzia.klucza.sprztowego.US

Wyczona

Tryb. standardowy

Tryb.gracza

43

lsk

i

KliknStart.>All.Programs.Wszystkie.programy.>ASUS.Gaming.Mouse.GX810. Mysz.dla.graczy.ASUS.GX810>ASUS.ROG.Gaming.Mouse.GX810.Mysz.dla. graczy.ASUS.GX810.ROGcelrchmieniarram. yietlenikazaneniejekrandczymyszdlaraczyAX80 dniazdaBkmteraikliknrzyciskOKcelnnerchmienia rram.

Uruchamianie.programu

Menu.gwne

3

6 7

8

11

17 18

4 5

10 9

1 2

1516 14 1213

19

23 24

22

21

20

44

lski

Elementy Opis

1. Wyietlaaktalnieykrzystyanytrybracymyszy.

2. Wyietlaaktalnyzimnaadaniabaterii.

3. ydybrmenrzijalnymfnkcjikaderzycisk/dziaania. *zczeeinfrmacjeatrztabelananastnejstrnie.

4. zalaybrarzdzielczzlistyrzijalnej. *zycjabdzieknfiralnatylktrybieracza.

5. rzesnsakabystaiartrdkcirzeijania.

6. rzesnsakabystaiartrdkcidkrtneklikania.

7. krtnieklikntiknabyrzetestaaktalnrdkdkrtneklikania.

8. Kliknabyzaisayknanezmianydybranerfil.

9. Kliknabyzastsaybranyrfil.

10. Kliknabydrzciyknanezmianyizamknekran.

11. Kliknabyzaisayknanezmianyizamknekran.

12. Kliknabyrzyrcistatniyknanezmiany.

13. Kliknabyyrelaczmyszy.

14. Zaznaczyabyczylbyczyzmianczcimyszyrzezrelacjartcidla siXi/lbsiY.

15. KliknabyyietliknMacrettins(staieniamakr).alsze szczee infrmacjeznajdjsinastrnie6.

16. Kliknabyyietliknreferences(referencje).alsze szczee infrmacje znajdjsinastrnie7.

17. Kliknabytrzynyrfil.

18. Klikncelzaimrtaniarfilzkmtera.

19. Klikncelyeksrtaniarfilnakmter.

20. Wyietlaczstdytyania.

21. krtniekliknnanazrfilceljejzmiany.

22. Niebieskakrkabkzycjiskazjeerfiljestaktyny.

23. Kliknabyyknakiybranerfil.

24. Kliknabysnybranyrfil. *Niemnasnaktynerfil.

45

lsk

i

Elementy Opis

Lewy.przycisk Naladjezachaniestandardeleerzyciskmyszy.

Prawy.przycisk Naladjezachaniestandarderaerzyciskmyszy.

Przycisk.przewiania. ybraninacisnrzyciskabyyknastandardefnkcje rzeijania.

Przecznik. rozdzielczoci.DPI

ybraninacisnrzyciskabystairzdzielczmyszy. *Ocjatajestidcznatylktrybieracza.

Ogie.cigy ybraninacisnrzyciskabyradziieciyrzety kliknijabyatakaktratfnkcjajestidentycznaztrzykrtnym klikniciemleymrzyciskiemmyszy.zczeeinfrmacjeznajdj sinastrnie8.

Nastpna.strona ybraninacisnrzyciskabyrzejdldaniaklejnejstrny ktratfnkcjajestidentycznaznaciniciem .

Poprzednia.strona ybraninacisnrzyciskabyrzejdldaniarzedniejstrny ktratfnkcjajestidentycznaznaciniciem .

Makro ybraninacisnrzyciskabyrchmilecenielbserilece ktremnayedytarzezmenMacrrfileManaement (Zarzdzanierfilemmakr).alsze szczee infrmacje znajdj sinastrnie.

Uruchom.program ybraninacisnrzyciskabyrchmikrelnyrram.alsze szczeeinfrmacjeznajdjsinastrnie0

Ustawienie.ednego. dotknicia

ybraninacisnrzyciskabyrchmitenrram.

M.komputer ybraninacinijtenrzyciskabytrzyknMjkmter.

Przegldarka.sieci. web

ybraninacinijtenrzyciskabyrchmidmyln rzeldarksiecieb.

E-mail.Klient ybraninacinijtenrzyciskabyrchmidmylnalikacj bsiemail.

Przewianie.w. lewo/w.prawo

ybraninacisnrzyciskabyrzeijale/ratakjakdla krtarzeijania. *FnkcjatadziaatylkalikacjachMicrsftOfficesystemie Winds7/Vista.

Wyciszenie ybraninacinijtenrzyciskabyczy/yczyyciszenie nci.

Odtwarzacz. multimediw/. Gra/pauza

ybraninacisnrzyciskabyrchmidmylnydtarzacz mltimedilbrchmi/rzeradtarzanieaktynym dtarzaczmltimedi.

Przecznik.aplikaci ybraninacisnrzyciskabyrzeczamidzydziaajcymi alikacjamiktratfnkcjajestidentycznaznaciniciem .

Przerzucanie.3D. ybraninacisnrzyciskabyrzeczaknazykrzystaniem rzerzcania3. *FnkcjadziaatylkWinds7.

46

lski

Menu.Macro.Settings.Ustawienia.makro

Elementy Opis

1. Kliknabyrchmizaisyanienacinitychklaiszyikliknnnieaby rzerazaisyanie. *lakaderfilmnazaisamaksymalnie40naciniklaiszy.

2. Zaznaczyabyinraszystkiedstyczasmidzynaciniciamiklaiszy.

3. Wyietlazaisanenaciniciaklaiszyidstyczasemidzynimi.

4. Kliknabyrzeniedry/ddybranenacinicieklaiszalbdst czasy.

5. Kliknabystaidstczasy.

6. Kliknabyybradstczasyktrymazstastainy.

7. Kliknabyybratrybtarzania. Raz.na.kliknicie:.Wybraabyrfilmakrbyyknyanyjedenrazkliknici

rzyciskmyszy. Kliknicie,.aby.powtrzy,.nastpne.kliknicie,.aby.zatrzyma:.Wybraaby

trzyyknanierfilmakrkliknicirzyciskmyszyiabyklejne klikniciezatrzymyayknanie.

Klikn,.aby.powtrzy:.Wybrailerazymazstatrzneyknyanie rfilmakrkliknicirzyciskmyszy.Iltrzeybrazlisty rzijalnej.

Przycinity,.aby.powtrzy:.Wybraabytrzyyknanierfilmakr rzytrzymanirzyciniterzyciskmyszyiabyzlnienierzycisk zatrzymyayknanie.

8. Kliknabyzaisayknanezmianydybranerfil.

cig dalszy na nastpnej stronie

5

7

8

11 10 9

1 2

12

13 14

3

4

6

15

47

lsk

i

Elementy Opis

1. ZaznaczyabykazyaiknOaskiadamianiaWinds.

2. Zaznaczabyczyfnkcjyietlanianaekranie.

3. Kliknabyzaisayknanezmianyizamknekran.

4. Kliknabydrzciyknanezmianyizamknekran.

Menu.Preference

3 4

2 1

Elementy Opis

9. Kliknabydrzciyknanezmianyizamknekran.

10. Kliknabyzaisayknanezmianyizamknekran.

11. Kliknabyrzyisaybranyrfildrzyciskmyszy.

12. Kliknabytrzynyrfilmakr.

13. Kliknabysnybranyrfilmakr.

14. Kliknabyyknakiybranerfilmakr.

15. krtniekliknnanazrfilceljejzmiany.

48

lski

Menu.urst.Fire.Ogie.cigy

Elementy Opis

1. KliknabyrchmimenBrstFire(Oieciy)

2. Kliknabyybratrybniacie. Tryb.3.pociskw:Wybierzabyystrzeliatrzyciskikliknicirzycisk myszy. Tryb.5.pociskw:Wybierzabyystrzeliaiciskikliknicirzycisk myszy. Tryb.cakowicie.automatyczny:Wybraabystrzelacakicieatmatycznie

kliknicirzyciskmyszyiabyklejnekliknicierzeryastrzelanie.

3. Kliknabyzaisayknanezmianyizamknekran.

4. Kliknabydrzciyknanezmianyizamknekran.

2

4 3

1

4

lsk

i

Menu.Macro.Settings.Ustawienia.makro

Elementy Opis

1. KliknabyrchmimenMacrettins(staieniamakr).

2. Kliknabyrzyisaybranyrfildrzyciskmyszy.

3. Niebieskakrkabkzycjiskazjeerfilmakrjestaktyny.

3

2

1

50

lski

Menu.Program.Selection.Wybr.programu

Elementy Opis

1. Kliknabyrchmimenrramelectin(Wybrrram).

2. Wisanazskrtrramktrymazstarchamianykliknicirzycisk myszy.

3. Wybrarramktrymazstarchamianykliknicirzyciskmyszy.

4. Kliknabydrzciyknanezmianyizamknekran.

5. Kliknabyzaisayknanezmianyizamknekran.

2

3

1

5 4

5

lsk

i

Menu.Paska.zada

1

3 2

4 5 6

Elementy Opis

1. Kiedyrramjestraniezainstalanyaskzadaidcznajestikna O.

2. Kliknabyrchmimenneterram.

3. KliknabydiedzificjalnstrnsieciafirmyA.

4. Kliknabyczy/yczyfnkcjyietlanianaekranie.

5. Kliknijabyyjzrram.

6. Kliknabysradziersjalikacjirazersjsternika.

5

lski

Manual.do.Utilizador

Rato.laser.para.ogos.ASUS.GX810.ROG

1

rts

Informao.sobre.o.software

ASUSTeK.COMPUTER.INC. Endere 5ieadeitaieiaian5

elefne +886843447 Fax +88680778 Email inf@ass.cm.t Website .ass.cm.t

Assistncia.tcnica elefne +86384 Assistncianline srt.ass.cm

ASUS.COMPUTER.INTERNATIONAL.Amrica Endere 800rrateWayFremntA453A elefne +50733777 Fax +506084555 Website sa.ass.cm

Assistncia.tcnica elefne +88787 Faxdaassistncia +8840883 Assistncianline srt.ass.cm

ASUS.COMPUTER.GmbH.Alemanha.&.ustria Endere arkrttr.340880atinenermany Fax +405 Website .ass.de Faxdaassistnciat .ass.de/sales

Assistncia.tcnica elefne(mnent) +4805003* elefne(istema/rtteis/Eee/) +4805000* Faxdaassistncia +405 Assistncianline srt.ass.cm

*04E/mintaartirdaredetelefnicafixanaAlemanha;04E/mintaartirdem telemvel.

rt

s

1

VerifiqeseaembalaemdseratlaserarajsAX80Ocntms itensseintes.

. Rato laser para ogos ASUS GX810 ROG. . . . . . . Receptor.Nano.US.2.4.GHz . 3.x.Pilhas.AAA . Guia.de.consulta.rpida . CD de suporte. .

ntactesevendedrsealmdsitensestiverdanificademfalta.

Contedo.da.embalagem

Resumo.das.especificaes

Nome.do.modelo X80

Cor ret

Tecnologia.sem.fios F4z

SO.suportado WindsX/WindsVista/Winds7

Dimenses.mm at:05()x66(W)x37() Peso at:8(semilha)

otes./.Interruptores

xBtesqerd/Btdireit/dadedeslcament xdadeinclinaaraaesqerda/direita xBteslaterais xBtdeMdanade(aenasaramddeJ)/

MdanadeAlica(aenasaramdNrmal) xBtdemdl

Resoluo 800/600/000/300di(AjstvelaenasnMddeJs)* *A resl est definida ara 00 n Md Nrmal. A

reslredefinidaaramddeJsde300. Tenso.de.entrada .5V

Pilhas.necessrias a3ilhasAAA

Asesecificaesestsjeitasaalteraessemavisrvi.

1

rts

Conhea.o.seu.rato.laser.para.ogos.ASUS GX810 ROG. .

OseratarajsOAX80ssimbtesqerdmbtdireit mardadedeslcamentdisbteslateraismbtdemdanadeem btdemdlexclsiv.

1 Btesqerd

2 Btdireit

3 dadedeslcament/dade inclina/Indicadrderesl*

4

Bt de Mdana de (aenas aramddeJ) Mdana de Alica (aenas ara

mdNrmal) 5 amadrat 6 tiO 7 Bteslaterais 8 Brrachaantiderraante 9 sdrat 10 ensrlaser 11 Btdemdl** 12 martimentdadatadrB 13 ecetrNanB.4z

Estado Indicaes iscarmavez 800di

iscardasvezes 600di

iscartrsvezes 000di

iscarqatrvezes 300di

*. Indicador.de.resoluo

cones Indicaes esliad

MdNrmal

MddeJ

**. .oto.de.modo.Duplo

23 4

5

6 7

8

7

1

9

12 9

11 9

13

10

rt

s

1

Instalar.a.bateria

As ilhas incldas n s recarreveis. e n retender tilizar rat drante m ln erd de tem remva as ilhas. se ilhas nvas de ti semelhante. VistqeseratX80defncinarcmaenasmailhassvel

ajstaresdratadicinandremvendmadasilhas. easilhasestiveremfracasqandliarratElaranja(rdadedeslca

ment)iscardrantemminteirdesliarseimediatamentesedeslcarrat clicarnmbt.

1 2 3

. calizeentalherximdaextremidadesterirdatama.lqe learsbreentalheelevanteatamaaraaremver.

. lqetrsilhasnresectivcmartimentreseitandalaridade crrecta.

3. ressineatamanadirecdassetasaraclclanvamente.

1

rts

Personalizar.o.rato.para.ogos.ROG.ASUS.GX810

Odesrtefrnecidinclimrramaesecialmentecncebidqelhe ermitecnfirarseratX80aradesfrtardetdasassasfncinalidades. lqedesrtenanidadeticaesiaasinstresnecrarainiciar rrama.

e a Exec atmtica NO estiver activada n se cmtadr rcre n cntedddesrteelficheirset.exe.Faadlcliqenmesm arainstalarrrama.

nslte manal d tilizadr incld n de srte ara bter instres detalhadasaraersnalizarserat.

Ligao.ao.PC

2

de ardar recetr B dentr d rat. ara ar eneria deslie rat qand n estiver a tilizl.

. etirerecetrBdcmartiment Bedeseidaclqeinterrtr dealimentanMdNrmalara tilizanrmalnMddeJs aramelhrdesemenhemjs.

. IntrdzarecetrBnma rtaBdisnvel.

1

Compartimento.do.adaptador.US

Desligado

Modo. Normal

Modo.de.Jogo

rt

s

1

liqeemStart.Iniciar>All.Programs.Todos.os.Programas>ASUS.Gaming. Mouse.GX810.Rato.para.ogos.ASUS.GX810>ASUS.ROG.Gaming.Mouse.GX810. Rato.para.ogos.ROG.ASUS.GX810araexectarrrama. assejaexibidecrilstradabaixlieseratarajsAX80 rtaBdcmtadredeiscliqeemOKaraexectarnvamente rrama.

Iniciar.o.programa

Menu.principal

3

6 7

8

11

17 18

4 5

10 9

1 2

1516 14 1213

19

23 24

22

21

20

10

rts

Itens Descrio

1. Exibemddratqeestasertilizad.

2. Exibenveldasilhas.

3. eleccinemafnaracadabt/acnalistaendente. *nslteatabelanainaseintearabtermaisinfrmaes.

4. eleccinemareslaartirdalistaendente. *EsteitemdesercnfiradaenasnmddeJ.

5. Arrastecntrldedeslizearaajstaravelcidadededeslcament.

6. Arrastecntrldedeslizearaajstaravelcidadededlcliqe.

7. Faadlcliqenestecnearatestaravelcidadededlcliqe.

8. liqearaardarasalteraesefectadasaerfilseleccinad.

9. liqearaalicarerfilseleccinad.

10. liqeararejeitarasalteraesefectadasefecharajanela.

11. liqearaardarasalteraesefectadasefecharajanela.

12. liqeararestararasltimasalteraesefectadas.

13. liqearaajstarasensibilidadedrat.

14. Marqearaactivardesactivaraalteradasensibilidadedratatravsdajste dsvalresdeixdeXe/eixdeY.

15. liqearaacederjanelaMacrettins(efiniesdeMacr).ara mais detalhes cnslteaina6.

16. liqearaacederjanelareferences(referncias).ara mais detalhes cnslte a ina7.

17. liqearacriarmnverfil.

18. liqearaimrtarmerfildsecmtadr.

19. liqearaexrtarmerfildsecmtadr.

20. Exibeafreqnciadeactaliza.

21. Faadlcliqennmederfilaraalterar.

22. Ontazlrximditemindicaerfilactiv.

23. liqearadlicarerfilseleccinad.

24. liqearaeliminarerfilseleccinad. *Oerfilactivndesereliminad.

rt

s

11

Itens Descrio .oto.principal Imitacmrtamentdbtesqerddrat.

Menu.de.contexto Qandseleccinadrimabtdireitaraexibirmende cntext.

oto.de. deslocamento

Qandseleccinadrimabtaraexectarafnde deslcament

Mudana.de.PPP Qandseleccinadrimabtaraseleccinararesldrat. *EstaestdisnvelaenasnmddeJs.

Disparo.de.raada Qandseleccinadrimabtaradisararderajadanmjde disarsfncinandcmmcliqetrilnbtesqerddrat. nslteaina8arabtermaisdetalhes.

Pgina.seguinte Qandseleccinadrimabtaraavanararaainaseinte. Fncinadamesmafrmaqeasteclas .

Pgina.anterior Qandseleccinadrimabtaravltarinaanterir. Fncinadamesmafrmaqeasteclas .

Macro Qandseleccinadrimabtaraexectarmcmand masriedecmandsqedereditarnmenMacrrfile Manaement(estdeerfildeMacr).ara mais detalhes cnslte aina.

Executar. programa

Qandseleccinadrimabtaraexectarrrama esecificad.ara mais detalhes cnslte a ina 0.

Configurao.de. um.toque

Qandseleccinadrimabtaraexectaresterrama.

O.meu. computador

QandseleccinadrimabtaraabrirajanelaOme cmtadr.

Navegador.Web QandseleccinadrimabtarainiciarnaveadrWeb redefinid.

Navegador.de. correio

Qandseleccinadrimabtarainiciaraalicadeemail redefinida.

Deslocar.para.a. Esqerda/Direita

Qandseleccinadrimabtaradeslcararaaesqerda/ direitatalcmardadeinclina. *EstafnaenasfncinanasalicaesMicrsftOfficens

sistemaserativsWinds7/Vista.

Sem.som Qandseleccinadrimabtaraactivar/desactivarmd semsm.

Leitor.Multimdia/ ogar/pausa

Qandseleccinadrimaestebtaraexectarleitrmltimdia redefinidararerdzir/clcaremasaarerdmleitr mltimdiaactiv.

Mudana.de. aplicao

Qandseleccinadrimabtaraalternarentrealicaesem execfncinanddamesmafrmaqeasteclas .

Flip-3D Qandseleccinadrimabtaramdardejanelastilizanda fnFli3. *EstafnfncinaaenasnsistemaerativWinds7.

1

rts

Menu.de.Definies.de.Macro

Itens Descrio

1. liqearacmeararavarasteclasecliqenvamentearaarar. *derravarat40teclasaracadaerfil.

2. Marqearainrartdsstemsdeatrasentreteclas.

3. Exibeasteclasravadasestemsdeatrasdrantearava.

4. liqearamverasteclasseleccinadasstemsdeatrasaracima/baix.

5. liqearainserirtemdeatras.

6. liqearaseleccinartemdeatrasqedesejainserir.

7. liqearaseleccinarmddereeti. Uma.vez.por.clique:.eleccinearaexectarerfildemacrmavezaclicarn

btdrat. Clicar.para.repetir.e.clicar.para.parar:.eleccinearareetiraexecderfil

demacraclicarnbtdratearaararclicandnvamentenbt. Clicar.para.repetir:.eleccineqantasvezesdesejareetiraexecderfilde

macraclicarnbtdrat.eleccineasreetiesnalistassensa. Manter.premido.para.repetir:.eleccinearareetiraexecderfildemacr

amanterremidbtdratearaararalibertarbt.

8. liqearaardarasalteraesefectadasaerfilseleccinad.

5

7

8

11 10 9

1 2

12

13 14

3

4

6

continua na pgina seguinte

15

rt

s

1

Itens Descrio

1. MarqearamstrarcnedeOnareadentificadWinds.

2. Marqearaactivarafndemenaresentadnecr.

3. liqearaardarasalteraesefectadasefecharajanela.

4. liqeararejeitarasalteraesefectadasefecharajanela.

Menu.Preferncias

3 4

2 1

Itens Descrio 9. liqeararejeitarasalteraesefectadasefecharajanela.

10. liqearaardarasalteraesefectadasefecharajanela.

11. liqearaatribirerfilseleccinadambtdrat.

12. liqearacriarmnverfildemacr.

13. liqearaeliminarerfildemacrseleccinad.

14. liqearadlicarerfildemacrseleccinad.

15. Faadlcliqennmederfilaraalterar.

1

rts

Menu.de.Disparo.de.raada

2

4 3

1

Itens Descrio

1. liqearaacederamendeisarderajada.

2. liqearaseleccinarmddedisarderajada. Modo.de.3.disparos:.eleccinearaefectartrsdisarsaclicarnbtdrat. Modo.de.5.disparos:.eleccinearaefectarcincdisarsaclicarnbtdrat. Modo.totalmente.automtico:.eleccinearadisarardefrmattalmente

atmticaaclicarnearaararaclicarnvamente.

3. liqearaardarasalteraesefectadasefecharajanela.

4. liqeararejeitarasalteraesefectadasefecharajanela.

rt

s

1

Menu.de.Definies.de.Macro

3

2

1

Itens Descrio

1. liqearaacederamendeefiniesdeMacr.

2. liqearaatribirerfilseleccinadambtdrat.

3. Ontazlrximditemindicaerfildemacractiv.

1

rts

Menu.de.Seleco.de.programa

Itens Descrio

1. liqearaacederamendeelecderrama.

2. Intrdzanmedatalhdrramaqedesejaexectaraclicarnbtdrat.

3. eleccinerramaqedesejaexectaraclicarnbtdrat.

4. liqeararejeitarasalteraesefectadasefecharajanela.

5. liqearaardarasalteraesefectadasefecharajanela.

2

3

1

5 4

rt

s

1

Menu.da.barra.de.tarefas

1

3 2

4 5 6

Itens Descrio

1. OltiOserexibidnabarradetarefasserramaestivercrrectamente instalad.

2. liqearaexibirmenrincialdesterrama.

3. liqearavisitarWebsiteficialdaA.

4. Marqearaactivar/desactivarafndemenaresentadnecr.

5. liqearasairdesterrama.

6. liqearaverificaraversdaalicaedcntrladr.

1

rts

ASUS ROG GX810

170

ASUSTeK COMPUTER INC. 15Li-TeRoad,Peitou,Taipei,Taiwan11259 +886-2-2894-3447 +886-2-2890-7798 E-mail info@asus.com.tw www.asus.com.tw

+86-21-38429911 support.asus.com

ASUS COMPUTER INTERNATIONAL ( ) 800CorporateWay, Fremont,CA94539,USA +1-510-739-3777 +1-510-608-4555 usa.asus.com

+1-812-282-2787 +1-812-284-0883 support.asus.com

ASUS COMPUTER GmbH ( ) HarkortStr.21-23,D-40880Ratingen,Germany +49-2102-959911 www.asus.de www.asus.de/sales

() +49-1805-010923* (//Eee/LCD) +49-1805-010920* +49-2102-9599-11 support.asus.com

*0.14 ,EUR0.42 .

171

ASUSGX810:

ASUS ROG GX810

USB 2,4

3

-

- , .

GX810

RF2.4

WindowsXP/WindowsVista/Windows7

() :105()66()37() :82()

/

1x// 1X:/ 2x 1DPI()/

() 1x

800/1600/2000/3200( ) **1200. 3200 .

1.5V

1-3

.

172

ASUS ROG GX810

ASUSGX810ROG, , , DPI, .

1

2

3 / /*

4

DPI( ) ( )

5 6 ROG 7 8 9 10 11 ** 12 USB

13 USB2,4

800dpi

1600dpi

2000dpi

3200dpi

*

**

23 4

5

6 7

8

7

1

9

12 9

11 9

13

10

173

. ,. . GX810,

. , (

) .

1 2 3

1. . , .

2. ,.

3. ,.

174

ASUS ROG GX810

GX810 -. .

,setup.exe. .

.

2

USB-. ,,.

1. USB , .

2. USB- USB.

1

USB

175

>>ASUS Gaming Mouse GX810 >ASUS ROG Gaming Mouse GX810. ,ASUSGX810 USBOK.

3

6 7

8

11

17 18

4 5

10 9

1 2

1516 14 1213

19

23 24

22

21

20

176

1. .

2. .

3. /. *.

4. . *.

5. .

6. .

7. .

8. .

9. .

10. .

11. .

12. .

13. .

14. XY.

15. . 16.

16. . 17.

17. .

18. .

19. .

20. .

21. .

22. .

23. .

24. . *.

177

Left Button .

Right Button , .

Scroll Button ,.

DPI Switch , . *.

Burst Fire , .18.

Page Forward , , .

Page Backward , , .

Macro , ,Macro ProfileManagement.19.

Launch Program , .20.

One Touch Setting ,.

My Computer ," ".

Web Browser , .

E-mail Client , .

Scroll Left / Right ,/. *MicrosoftOffice Windows7/Vista.

Mute ,/.

Media Player/ PlayPause

,/ -.

Application Switch , , .

Flip-3D , Flip3D. *Windows7.

178

1. ,. *40.

2. .

3. .

4. /.

5. .

6. .

7. . : .

, : .

:, . .

: .

8. .

5

7

8

11 10 9

1 2

12

13 14

3

4

6

15

179

1. ROGWindows.

2. .

3. .

4. .

3 4

2 1

9. .

10. .

11. .

12. .

13. .

14. .

15. .

180

Burst Fire

1. BurstFire.

2. burstfire. 3 Rounds Mode:. 5 Rounds Mode:. Full Automatic Mode: .

3. .

4. .

2

4 3

1

181

1. .

2. .

3. .

3

2

1

182

1. .

2. , .

3. ,.

4. .

5. .

2

3

1

5 4

183

1

3 2

4 5 6

1. ROG.

2. .

3. ASUS.

4. /.

5. .

6. .

184

Manual.de.utilizare

Mouse.pentru.ocuri.GX810.ROG

1

m n

Informaii.de.contact

ASUSTeK.COMPUTER.INC. Adres 5ieadeitaieiaian5 elefn +886843447 Fax +88680778 Email inf@ass.cm.t iteWeb .ass.cm.t

Asisten.tehnic elefn +86384 Asistennline srt.ass.cm

ASUS.COMPUTER.INTERNATIONAL.America Adres 800rrateWayFremntA453A elefn +50733777 Fax +506084555 iteWeb sa.ass.cm

Asisten.tehnic elefn +88787 Faxdeasisten +8840883 Asistennline srt.ass.cm

ASUS.COMPUTER.GmbH.Germania.i.Austria Adres arkrttr.340880atinenermany Fax +405 iteWeb .ass.de ntactnline .ass.de/sales

Asisten.tehnic elefn(mnente) +4805003* elefn(istem/Ntebk/Eee/) +4805000* Faxdeasisten +405 Asistennline srt.ass.cm

*04er/mintdeelinietelefnicfixdinermania;04er/mintdeentelefnmbil.

1

m

n

VerificaidacnachetlmselientrjcriAX80Oexist rmtarelearticle:

. Mouse.pentru.ocuri.ASUS.GX810.ROG. . Nano US 2.4 GHz receiver. . . . . aterii AAA x 3. . . . Ghid de pornire rapid. . . . CD de asisten. .

acricaredinarticleledemaisslisetesaestedeteriratcntactai imediatdistribitrl.

Coninutul.pachetului

Rezumatul.specificaiilor

Nume.model X80

Culoare Ner

Tehnologie.fr.fir F4z

Compatibilitate.sistem. de.operare WindsX/WindsVista/Winds7

Dimensiuni.mm Mse:05()x66(l)x37() Greutate Mse:8(frbaterie)

utoane/comutatoare

xbtnstna/btndreata/rtidedefilare xrtidedefilarestna/dreata xbtanelaterale xcmtatrI(nmaientrmdlamin(Jcri))/

cmtatrdealicaii(nmaientrmdltandard) xcmtatrmdal

Rezoluie 800/600/000/300di(relabilnmainmdlJc)* *ezlia este fixat la 00di n mdl tandard. ezlia

imlicitentrmdlamin(Jcri)estede300di. Tensiune.de.intrare .5V

Cerine.de.baterie ntrei3bateriiAAA

ecificaiilesntsseschimbriifrntificarerealabil.

1

m n

Prezentarea.mouse-ului.pentru.ocuri.ASUS GX810 ROG. .

MselentrjcriOAX80esteechiatcnbtnstnanbtn dreatartidedefilaredbtanelateralencmtatrIincmtatr demdalriectatsecial.

1 Btnstna

2 Btndreata

3 tidedefilare/tidedefilare/ indicatrderezlie*

4

mtatr I (nmai entr mdl amin(Jcri)) mtatr de alicaii (nmai entr mdltandard)

5 aacdemse 6 ilO 7 Btanelaterale 8 esindecacicrezistentlaalnecare 9 iciaremse 10 enzrlaser 11 mtatrmdal** 12 martimentcheiehardareB 13 NanB.4zreceiver

Stare Indicaii liiredat 800di

liirededri 600di

liiredetreiri 000di

liiredeatrri 300di

*. indicator.de.rezoluie

Pictograme Indicaii Orit

Mdtandard

Mdamin (Jcri)

**. .Comutator.mod.Dual.

23 4

5

6 7

8

7

1

9

12 9

11 9

13

10

1

m

n

Instalarea.bateriei

Bateriainclsnachetnestencrcabil. ac n tilizai msel entr eriad ndelnat scatei bateria. tilizai baterie n sa de ti similar. earecemselX80atefncinacsinrbaterieteisajstai

retateamseliadndsascndnasadbaterii. ndmselestealimentatcbateriidescrcateElrtcali(rtiade defilare)clietetimdenmintisestineimediatcnddelasaimsel sacndfaceiclicenbtn.

1 2 3

. calizaicanelraaflataraedecatldessalcaacli.neideetl maredeasracanelriiiridicaicaaclentralscate.

. Intrdceitreibateriinfanteinndcntdelaritateacrect.

3. Asaicaaclndireciaseilrentralremnta.

10

m n

Particularizarea.mouse-ului.pentru.ocuri.ROG.ASUS.GX810

ac inea Exectare atmat N este activat e cmter rsfii cnintllideasistenentrasifiierlsetup.exe.Faceiclicdbl eacestaentrainstalarraml.

nsltai manall tilizatrli de e l de asisten entr instrcini detaliaterivindmdldearticlarizareamseli.

Conectarea.la.PC

2

tei stca recetrl B n interirl mseli. entr a ecnmisi enerie rii alimentarea cnd n tilizai msel.

. cateirecetrlBdin cmartimentlBiaicmtai ntrertrldealimentarelamdl tandardentrtilizarenrmalsa lamdlJcentrerfrmanmai bnajcrilr.

. InserairecetrlBntrn rtBdisnibil.

1

Compartiment.cheie.hardware.US

Oprit

Mod. Standard.

Mod.Gaming.

ldeasistendinachetincldenrramriectatsecialcarevermite scnfiraimselX80entratilizatatecaracteristicileacestia.Aezai ldeasistennnitateaticirmaiinstrciniledeeecranentralansa rraml.

11

m

n

FaceicliceStart.>All.Programs.Toate.programele>ASUS.Gaming.Mouse. GX810.Mouse.pentru.ocuri.ASUS.GX810>ASUS.ROG.Gaming.Mouse.GX810. Mouse.pentru.ocuri.ASUS.ROG.GX810entralansarraml. acaareecranldemaijscnectaimselentrjcriAX80lartl BdeecmteriaifaceicliceOKentrarelansarraml.

Lansarea.programului

Meniul.principal

3

6 7

8

11

17 18

4 5

10 9

1 2

1516 14 1213

19

23 24

22

21

20

1

m n

Elemente Descrieri

1. Afieazmdldemsecrentecareltilizai.

2. Afieaznivellcrentalbateriei.

3. electaifncieentrfiecarebtn/acinedinlistavertical. *nsltaitabelldeeainarmtareentrmaimltedetalii.

4. electairezliedinlistavertical. *Acestelementdevinecnfirabilnmainmdlamin(Jcri).

5. lisaicrsrlentraajstavitezadedefilare.

6. lisaicrsrlentraajstavitezadedblclic.

7. Faceidblcliceaceastictramentratestavitezacrentdedblclic.

8. Faceiclicentrasalvamdificrileefectatelarfillselectat.

9. Faceiclicentraalicarfillselectat.

10. Faceiclicentrarennalamdificrileefectateianchideecranl.

11. Faceiclicentrasalvamdificrileefectateianchideecranl.

12. Faceiclicentrarestabililtimelesetriefectate.

13. Faceiclicentraajstasensibilitateamseli.

14. Bifaientraactivasaadezactivamdificareasensibilitiimselirin ajstareavalrilraxeiXi/saaleaxeiY.

15. FaceiclicentraafiafereastraMacrettins(etrimacrcmenzi).nsltai aina6entrmaimltedetalii.

16. Faceiclicentraafiafereastrareferences(referine).nsltai aina 7 entr maimltedetalii.

17. Faceiclicentracreanrfiln.

18. Faceiclicentraimrtanrfildeecmter.

19. Faceiclicentraexrtanrfilecmter.

20. Afieazratadeinterareciclic.

21. Faceidblclicenmelederfilentralmdifica.

22. nctlalbastrdelnelementindicrfillactiv.

23. Faceiclicentradblarfillselectat.

24. Faceiclicentratererfillselectat. *rfillactivnseatetere.

1

m

n

Elemente Descrieri uton.principal imleazcmrtamentlbtnlidemsestnastandard.

Meniu.contextual ndseselecteazasaiebtnentraafiamenilcntextalde clicdreata.

uton.de.defilare ndseselecteazasaiebtnentraexectafnciadedefilare standard.

Comutator.DPI ndseselecteazasaiebtnentraselectarezliede mse. *Aceastineaarenmainmdlamin(Jcri).

Rafal ndseselecteazasaiebtnentraexectarafalntrnjc deticlicentratacceeaceesteidenticcclicltrilebtnlde msestna.nsltaiaina8entrdetalii.

Pagin.nainte ndseselecteazasaiebtnentrafacesaltlaaina rmtarevizalizatceeaceesteidenticcasareae .

Pagin.napoi ndseselecteazasaiebtnentrafacesaltlaaina anteriarvizalizatceeaceesteidenticcasareae .

Macro ndseselecteazasaiebtnentraexectacmandsa seriedecmenziecareleteieditarinmenilMacrrfile Manaement(estinarerfilmacrcmenzi).nsltai aina entrmaimltedetalii.

Lansare.program ndseselecteazasaiebtnentralansarramlsecificat. nsltaiaina0entrmaimltedetalii.

Setare.cu.o. singur.atingere

ndseselecteazasaiebtnentralansaacestrram.

Computerul.meu ndseselecteazasaiebtnentradeschidefereastraMymter (mterlme).

rowser.Web ndseselecteazasaiebtnentralansabrserlWebimlicit.

rowser.de.e-mail ndseselecteazasaiebtnentralansaalicaiadeemail imlicit.

Defilare.spre. stnga/Oprire

ndseselecteazasaiebtnentradefilasrestna/dreata cartidedefilare. *AceastfnciefncineaznmainalicaiiMicrsftOfficesb

Winds7/Vista.

Fr.sunet ndseselecteazasaiebtnentraactiva/adezactivamdlfr snet.

Redare/Pauz/ PlayPause

ndseselecteazasaiebtnentralansalayerlmedia imlicitsaareda/alasanazredareantrnlayermediaactiv.

Comutator.de. aplicaii

ndseselecteazasaiebtnentracmtantrealicaiilen exectareceeaceesteidenticcasareae .

Rsfoire.3D ndseselecteazasaiebtnentracmtaferestretiliznd fnciaFli3(sfire3). *AceastfnciefncineaznmaisbWinds7.

1

m n

Meniul.Macro.Settings.Setri.macrocomenzi

Elemente Descrieri

1. Faceiclicentranceesnreistraiasriledetasteifaceiclicdinnentr ari. *teisnreistraimaximm40deasridetasteentrfiecarerfil.

2. Bifaientrainratatentrzieriletemraledintreasriledetaste.

3. Afieazasriledetastenreistrateintrzieriletemraledintimlnreistrrii.

4. Faceiclicentradelasanss/njsasriledetastesantrzieriletemrale selectate.

5. Faceiclicentrainserantrziereatemral.

6. Faceiclicentraselectaintervalldentrziereecaredriislinserai.

7. Faceiclicentraselectamdldereetare. O.singur.dat.pe.clic:.electaientraexectarfilldemacrcmenzi

sinrdatcndfaceiclicebtnldemse. Clic.pentru.repetare,.urmtorul.clic.pentru.oprire:.electaientrareeta

exectarearfillidemacrcmenzicndfaceiclicebtnldemseifacei clicdinnebtnentrari.

Clic.pentru.repetare:.electainmrldereetrientrexectarearfillide macrcmenzicndfaceiclicebtnldemse.electainmrldereetri dinlistavertical.

Apsare.pentru.repetare:.electaientrareetaexectarearfillide macrcmenzicndineiasatbtnldemseieliberaibtnlentra ri.

8. Faceiclicentrasalvamdificrileefectatelarfillselectat.

5

7

8

11 10 9

1 2

12

13 14

3

4

6

a continuat pe pagina urmtoare

15

1

m

n

Elemente Descrieri

1. BifaientraafiaictramaOnznadentificareWinds.

2. Bifaientraactivafnciadeafiareeecran.

3. Faceiclicentrasalvamdificrileefectateianchideecranl.

4. Faceiclicentrarennalamdificrileefectateianchideecranl.

Meniul.Preferine

3 4

2 1

Elemente Descrieri 9. Faceiclicentrarennalamdificrileefectateianchideecranl.

10. Faceiclicentrasalvamdificrileefectateianchideecranl.

11. Faceiclicentraasciarfillselectatnibtndemse.

12. Faceiclicentracreanrfildemacrcmenzin.

13. Faceiclicentratererfilldemacrcmenziselectat.

14. Faceiclicentradblarfilldemacrcmenziselectat.

15. Faceidblclicenmelederfilentralmdifica.

1

m n

Meniul.urst.Fire.Rafal

2

4 3

1

Elemente Descrieri

1. FaceiclicentralansamenilBrstFire(afal).

2. Faceiclicentraselectamdlderafal. Mod.3.lovituri:.electaientraexectatreilvitricndfaceiclicebtnl

demse. Mod.5.lovituri:.electaientraexectacincilvitricndfaceiclicebtnl

demse. Mod.automat.complet:.electaientraexectafcatmatcmletcndfacei

clicebtnldemseifaceiclicdinnentrari.

3. Faceiclicentrasalvamdificrileefectateianchideecranl.

4. Faceiclicentrarennalamdificrileefectateianchideecranl.

1

m

n

Meniul.Macro.Settings.Setri.macrocomenzi

3

2

1

Elemente Descrieri

1. FaceiclicentralansamenilMacrettins(etrimacrcmenzi).

2. Faceiclicentraasciarfillselectatnibtndemse.

3. nctlalbastrdelnelementindicrfilldemacrcmenziactiv.

1

m n

Meniul.Program.Selection.Selectare.programe

Elemente Descrieri

1. Faceiclicentralansamenilrramelectin(electarerrame).

2. Intrdceinmelecmenziiraidearramliecaredriislexectaicnd faceiclicebtnldemse.

3. electainrramecaredriislexectaicndfaceiclicebtnldemse.

4. Faceiclicentrarennalamdificrileefectateianchideecranl.

5. Faceiclicentrasalvamdificrileefectateianchideecranl.

2

3

1

5 4

1

m

n

Meniul.Taskbar.ar.de.activiti

1

3 2

4 5 6

Elemente Descrieri

1. ilaOaarenbaradeactiviticndrramlesteinstalatcrect.

2. Faceiclicentralansamenilrincialalacestirram.

3. FaceiclicentravizitasitelWebficialA.

4. Faceiclicentraactiva/adezactivafnciadeafiareeecran.

5. Faceiclicentraieidinacestrram.

6. Faceiclicentraverificaversineaalicaieiiversineadriverli.

00

m n

Nvod.na.obsluhu

Hracia.my.ASUS.GX810. ROG

0

lvensky

Kontaktn.informcie

ASUSTeK.COMPUTER.INC. Adresa 5ieadeitaieiaian5 elefn +886843447 Fax +88680778 Email inf@ass.cm.t Webvstrnka .ass.cm.t

Technick.podpora Adresa +86384 Onlinedra srt.ass.cm

ASUS.COMPUTER.INTERNATIONAL.Amerika Adresa 800rrateWayFremntA453A elefn +50733777 Fax +506084555 Webvstrnka sa.ass.cm

Technick.podpora elefn +88787 Faxvslddeleniadry +8840883 Onlinedra srt.ass.cm

ASUS.COMPUTER.GmbH.Nemecko.a.Raksko Adresa. arkrttr.340880atinenermany Fax +405 Webvstrnka .ass.de Onlinekntakt .ass.de/sales

Technick.podpora elefn(Kmnenty) +4805003* elefn(ystm/Ntebk/Eee/) +4805000* Faxvslddeleniadry +405 Onlinedra srt.ass.cm

*04EO/mintazevnejevnejtelefnnejsietevNemeck;04EO/mintazmbilnh telefn.

0

l v

en sk

y

VsvjmbalenhrskejmyiAX80skntrljtenasledjcelky:

. Hracia.my.ASUS.GX810.ROG . Nano.US.2.4.GHz.receiver . 3.x.AAA.batrie . Strun.nvod.na.pouvanie . CD.s.podporou

Akjektrkvekzhrevedenchliekkdenalebchbasjtesa kamitessvjimredajcm.

Obsah.balenia

Shrnn.prehad.technickch.pecifikci

Nzov.modelu X80

Farba ierna

Technolgia.bezdrtove. komunikcie

F4z

Podpora.OS WindsX/WindsVista/Winds7

Rozmery.mm My: 05() x 66() x 37(V) Hmotnos My:8(bezbatrie)

Tlaidl./.prepnae

xavtlaidl/ravtlaidl/kliesk xav/ravsklnkliesk xbntlaidl xrenaI(lenrereimhraniahier)/renaalikci

(lenretandardnreim) xrenadlnehreim

Rozlenie

800/600/000/300di(dsanastavilenvreimehrania hier)* Rozlenie je v tandardnom reime pevne nastaven na hodnotu 1200dpi. redvlenrzlenierereimhraniahierje300di.

Vstupn.naptie .5V

Poiadavky.na.batrie a3batrietyAAA

ecifikciembyzmenenbezredchdzajcehzrnenia.

0

lvensky

Spoznate.svou.hrsku.my.ASUS.GX810.ROG

VaamynahraniehierAX80Ojevybavenavmtlaidlmravm tlaidlmklieskmdvmibnmitlaidlamitlaidlmnarenanieIa ecilnenavrhntmtlaidlmnarenaniedlnehreim.

1 avtlaidl

2 ravtlaidl

3 kliesk/klnkliesk/indiktr rzlenia*

4 rena I (len re reim hrania hier) rena alikci (len re tandardn

reim) 5 Krytmyi 6 O 7 bntlaidl 8 rtimykvmendizajn 9 tamyi 10 aservsnma 11 renadlnehreim 12 riehradkanaBdnle 13 NanB.4zreceiver

Stav Indikcie Blikneraz 800di

Bliknedvakrt 600di

Bliknetrikrt 000di

Bliknetyrikrt 300di

*. .indiktor.rozlenia

Ikony Indikcie Vynt

tandardnreim

eimhraniahier

**. .Prepna.dulneho.reimu

23 4

5

6 7

8

7

1

9

12 9

11 9

13

10

0

l v

en sk

y

Vloenie.batrie

rilenabaterijanilnilna. emikedaljasanebsterabljalidstranitebaterij. rabitenvbaterijalibaterijdbnevrste. retevaamyX80mefnvalensjednbatrihmtnssvjej myimeteraviridanmalebvybratmjednejalebdvchbatri. Akzanetemysslabmibatriamiasjednejmintybdeblikaranv

Eindiktr(rlvaciekliesk)avynesakamitesntmyialeb klikntnatlaidl.

1 2 3

. Njditedrkvblzkstihrnejkncvejastikryt.vjalecmiestnitena drkakrytsnmtezdvihntmnahr.

. trbnvltetribatrie;dvajteritmzrnasrvnlarit.

3. Krytnasatezatlaenmvsmerek.

0

lvensky

Prispsobenie.myi.na.hranie.ASUS.GX810.ROG

dvansdrbsahjeecilnenavrhntrramktrvm mjenastavimyX80takabystemhlivavetkyjejfnkcie. tickejmechanikyvltesdrasstenierramvyknajteda kynvnabrazvke.

Akniejevvamtaivlenatmaticksstenierehadajte bsahsdranjditesbrset.exe.vakrtnakliknitearram naintaljte.

etailnkynyssberissbeniasvjejmyinjdetevnvdena bslhnasdr.

Prikluitev.na.raunalnik

2

Bsrejemniklahkshranitetdivmik. Zavarevanjeenerijevednizkljitemikkadarjenerabljate.

. ZBriehradkyvyberteBrijmaa hlavnvynarenitedtandardnh reimvradetandardnh vaniaalebdreimhrania hierredsiahntieleiehhracieh vkn.

. NvisrejemnikBvstavitev razlljivavrataB.

1

Priehradka.na.US.dongle

Vyp.

tandardn. reim

Reim.hrania.hier

0

l v

en sk

y

rramsstteklikntmnaStart.tart>All.Programs.Vetky.programy. >ASUS.Gaming.Mouse.GX810.My.na.hranie.hier.ASUS.GX810>ASUS.ROG. Gaming.Mouse.GX810.My.na.hranie.hier.ASUS.ROG.GX810. AksabjavdlznzrnenbrazvkarijtesvjmynahraniehierA X80kBrttaaaklikntmnaOKtvnesstiterram.

Spustenie.programu

Hlavn.ponuka

3

6

7

8

11

17 18

4 5

10 9

1 2

1516 14 1213

19

23 24

22

21

20

0

lvensky

Poloky Popisy

1. Zbrazjeaktlnevanreimmyi.

2. Zbrazjeaktlnrvenabitiabatrie.

3. Vrmcirzbavaciehzznamvybertefnkcirekadtlaidl/akci. *Viacinfrmcinjdetevtabkenanasledjcejstrane.

4. Vrmcirzbavaciehzznamvyberterzlenie. *tlkmnnaknfirvajedinevreimehraniahier.

5. ahanmsvaanastavterchlsrlvania.

6. ahanmsvaanastavterchlsdvjithklikntia.

7. vakrtkliknitenattiknabystetestvaliaktlnrchlsdvjithklikntia.

8. Klikntmltevamirealizvanzmenydvybranhrfil.

9. Klikntmijetevybranrfil.

10. Klikntmzrtevamizrealizvanzmenyazatvrtebrazvk.

11. Klikntmltevamizrealizvanzmenyazatvrtebrazvk.

12. Klikntmbnvteslednvamizrealizvannastavenia.

13. Klikntmnastavtecitlivsmyi.

14. Klikntmzaktivjetealebdeaktivjetecitlivsmyimcnastaveniahdntre sXa/alebsY.

15. KlikntmzbrazteknMacrettins(Nastaveniamakra).drbnstinjdetena strane6.

16. Klikntmzbrazteknreferences(referencie).drbnstinjdetenastrane7.

17. Klikntmvytvrtenvrfil.

18. Klikntmvyknteimrtvanierfilzsvjhtaa.

19. Klikntmvyknteexrtvanierfildsvjhtaa.

20. Zbrazjerchlsvzrkvania.

21. vakrtkliknitenanzvrfilazmetejehnzv.

22. Mdrbdkavedalkyznajeaktvnyrfil.

23. Klikntmvytvrtedliktvybranhrfil.

24. Klikntmvymaetevybranrfil. *Aktvnyrfilvymazanemn.

0

l v

en sk

y

Poloky Popisy av.tlaidlo Fnjeaktandardnavtlaidlmyi.

prav.tlaidlo Fnjeaktandardnravtlaidlmyi.

Rolovacie.tlaidlo vbestlaentlaidladjdekvyknvanitandardnejfnkcie rlvania.

Prepna.DPI vbestlaenmtlaidlazvlterzleniemyi. *tmnssazbrazjedinevreimehraniahier.

Vstrel rizvlenastlaentlaidlavykntevstrelvrmcihrytytk klikntjettnstrjitmklikntmavmtlaidlmmyi. drbnstinjdetenastrane8.

Na.nasleducu. strnku

vbestlaenmtlaidlarejdetenanasledjcvamirezeran strnkjettnsstlaenmtlaidiel .

Na.predchdzacu. strnku

vbestlaenmtlaidlarejdetenaredchdzajcvamirezeran strnkjettnsstlaenmtlaidiel .

Makro rizvlenastlaentlaidlasstterkazalebsrirkazvktr meteravivrmcinkyMacrrfileManaement(rva rfilmakra).drbnstinjdetenastrane.

Spusti.program rizvlenastlaentlaidlassttevamivyecifikvanrram. drbnstinjdetenastrane0.

Nastavenie.ednho. dotyku

rizvlenastlaentlaidlassttetentrram.

M.pota rizvlenastlaentlaidlatvrteknMymter(Mjta).

Webov.prehadva rizvlenastlaentlaidlasstteredvlenebvrehadva.

E-mail.Klient rizvlenastlaentlaidlasstteredvlenemailvalikci.

Rolovanie.doava./. doprava

rizvlenastlaentlaidlameterlvadava/dravadbne akvradesklnhklieskamyi. *tfnkciafnjejedinevradealikcibalkaMicrsftOffice

vrstrederanchsystmvWinds7/Vista.

Sti.zvuk rivybranastlaentlaidlazanete/vynetereimstenia.

Prehrva. mdi/Prehrvanie/ Pozastavenie

rivbeastlaentlaidlasasstvamiredvlenrehrva mdialebdjdekrehrvani/zastavenirehrvaniavrmci aktlnehrehrvaamdi.

Prepna.aplikci vbeastlaentlaidladketerenamedzisstenmi alikciamijettnsvanmstlaeniaklvesv .

Priestorov. prepnanie.okien.

vbeastlaentlaidladketerenamedziknamimc fnkcieriestrvhrenaniakien. *tfnkciafnjelenvradevaniasystmWinds7.

10

lvensky

Ponuka.nastaven.makra

Poloky Popisy

1. Klikntmssttezznamstlaniaklvesvatvnmklikntmzznamzastavte. *rekadrfilmetezaznamenamaximlne40stlaenklvesv.

2. Zaiarkntmdjdekinrvaniasvchneskrenmedzistlaeniamiklvesv.

3. Zbrazjezaznamenanstlaeniaklvesvaasvneskreniaaszznam.

4. Klikntmsnietevybranstlaeniaklvesvalebasvneskrenianahr/ nadl.

5. Klikntmvlteasvneskrenie.

6. Klikntmzvlteasvneskreniektrchcetevli.

7. Klikntmzvltereimakvania. Raz.pri.kliknut:.Vbsarfilmakravyknkliknttlaidlmmyiraz. Po.kliknut.zopakova,.pri.alom.kliknut.zastavi:.Vbzakjetevyknanie

rfilmakrarikliknttlaidlmmyiazastavtealmklikntmtlaidlm. Po.kliknut.zopakova:.Zvtekkkrtsamrfilmakrazakvakliknt

tlaidlmmyi.Mnstizakvaniazvtevrmcirzbavaciehzznam. Zopakova.pri.stlaen:.Vbzakjetevyknanierfilmakraridran

stlaenhtlaidlamyiazastavtevnenmtlaidla.

8. Klikntmltevamirealizvanzmenydvybranhrfil.

5

7

8

11 10 9

1 2

12

13 14

3

4

6

pokraovanie na alej strane

15

11

l v

en sk

y

Poloky Popisy

1. ZaiarkntmzbrazteiknOvrmciblastiznmenWinds.

2. Zaiarkntmzaktivjetefnkcizbrazenianabrazvke.

3. Klikntmltevamizrealizvanzmenyazatvrtebrazvk.

4. Klikntmzrtevamizrealizvanzmenyazatvrtebrazvk.

Preferencie.menu

3 4

2 1

Poloky Popisy 9. Klikntmzrtevamizrealizvanzmenyazatvrtebrazvk.

10. Klikntmltevamizrealizvanzmenyazatvrtebrazvk.

11. Klikntmriradtevybranrfiltlaidlmyi.

12. Klikntmvytvrtenvrfilmakra.

13. Klikntmvymaetevybranrfilmakra.

14. Klikntmvytvrtedliktvybranhrfilmakra.

15. vakrtkliknitenanzvrfilazmetejehnzv.

1

lvensky

Ponuka.pre.vstrel

Poloky Popisy

1. Klikntmdjdeknataninkyrevstrel.

2. Klikntmzvltereimvstrel. Reim.3.dvok:.Vbstlaentlaidlavylitetridvky. Reim.5.dvok:.Vbstlaentlaidlavylitedvk. Plne.automatick.reim:.Vbstlaentlaidladjdeklneatmatickej

strebe;strebzastavtetvnmklikntm.

3. Klikntmltevamizrealizvanzmenyazatvrtebrazvk.

4. Klikntmzrtevamizrealizvanzmenyazatvrtebrazvk.

2

4 3

1

1

l v

en sk

y

Ponuka.nastaven.makra

Poloky Popisy

1. Klikntmdjdeknataninkynastavenmakra.

2. Klikntmriradtevybranrfiltlaidlmyi.

3. Mdrbdkavedalkyznajeaktvnyrfilmakra.

3

2

1

1

lvensky

Ponuka.voby.programu

Poloky Popisy

1. Klikntmdjdeknataninkyvbyrram.

2. Natenzvdkazrerramktrchcetesstikliknttlaidlmmyi.

3. Zvterramktrchcetesstikliknttlaidlmmyi.

4. Klikntmzrtevamizrealizvanzmenyazatvrtebrazvk.

5. Klikntmltevamizrealizvanzmenyazatvrtebrazvk.

2

3

1

5 4

1

l v

en sk

y

Ponuka.panela.loh

1

3 2

4 5 6

Poloky Popisy

1. AkjerramsrvnenaintalvanvrmcianelalhsazbrazlO.

2. Klikntmdjdeknatanihlavnejnkythtrram.

3. klikntnavtviteficilnebvlkalitslnstiA.

4. Zaiarkntmzaktivjete/deaktivjetefnkcizbrazenianabrazvke.

5. Klikntmtentrramzatvrte.

6. Klikntmskntrljeteverzialikcieaverzivldaa.

1

lvensky

Prironik.za.uporabo

Igralna.mika.ASUS.GX810.ROG

1

lvenina

Kontaktne.informacie

ASUSTeK.COMPUTER.INC. Naslv 5ieadeitaieiaian5 elefn +886843447 Faks +88680778 Email inf@ass.cm.t letnastran .ass.cm.t

Tehnina.podpora elefn +86384 letnadra srt.ass.cm

ASUS.COMPUTER.INTERNATIONAL.Amerika Naslv 800rrateWayFremntA453A elefn +50733777 Faks +506084555 letnastran sa.ass.cm

Tehnina.podpora elehne +88787 Fakszadr +8840883 letnadra srt.ass.cm

ASUS.COMPUTER.GmbH.Nemia.in.Avstria Naslv. arkrttr.340880atinenermany Faks +405 letnastran .ass.de letninaslv .ass.de/sales

Tehnina.podpora elefn(kmnente) +4805003* elefn(sistem/rensnik/Eee/) +4805000* Fakszadr +405 letnadra srt.ass.cm

*04E/minizfiksneamrejavNemiji04E/minizmbilnihtelefnv.

l v

en

in a

1

VaketziralnmikAX80iitenaslednjeelemente:

. Igralna.mika.ASUS.GX810.ROG . Nano.US.2.4.GHz.receiver . 3.x.AAA.baterie . Vodi.za.hitri.zaetek . CD.s.podporo

eazitedajekateriklidelementvkdvanalimanjkatakjstitev stiksrdajalcem.

Vsebina.paketa

Povzetek.tehninih.lastnosti

Ime.modela X80

arva rna

rezina.tehnologia F4z

Podpora.OS WindsX/WindsVista/Winds7

Mere.mm Mika:05()x66()x37(V) Tea Mika:8(brezbaterije)

Gumbi/Stikala

xlevimb/desnimb/klesce xlev/desnklescezariladitevnaiba xstranskamba xstikalI(samIralninain)/alikacijskstikal(sam

tandardninain) xstikalzavjninain

Lolivost 800/600/000/300di(nastavljivsamvnainire)* *ljivstjevstandardnemnainnastavljenana00di.

rivzetalljivstzaIralninainje300di. Vhodna.napetost .5V

Ustrezne.baterie d3AAAbaterije

ecifikacijeselahksremenijbrezredhdneabvestila.

0

lvenina

Spoznate.svoo.igralno.miko.ASUS.GX810.ROG

IralnamikaAX80Oimaleviindesnimbklescedvastranskamba stikalIinsebejblikvanstikalzavjninain.

1 levimb

2 desnimb

3 klesce/Klescezariladitevnaiba/ kazalniklljivsti*

4 stikal I (sam Iralni nain) alikacijsk stikal (sam tandardni

nain) 5 krvekmike 6 tiO 7 stranskamba 8 Nezdrsljivmijasthije 9 Nemike 10 aserskisenzr 11 stikalzavjninain** 12 rstrzakljB 13 NanB.4zreceiver

Stane Indikatori trineenkrat 800di

trinedvakrat 600di

trinetrikrat 000di

trinetirikrat 300di

*. Resolution.indicator

Ikone Indikatori Izklljen

tandardninain

Iralninain

**. .stikalo.za.Dvoni.nain

23 4

5

6 7

8

7

1

9

12 9

11 9

13

10

l v

en

in a

1

Vstavlane.bateri

asbaterassministradasnsnrecarables. iniensatilizarelratndranteneridrlnaddetiemextraia

lasbateras. tilicebaterasnevasdetisimilar. Ker mika GX810 lahko deluje s samo eno baterijo, lahko prilagajate teo mike,

tako da dodate ali odstranite eno ali dve bateriji. KjemikavklljenabaterijeaizraznjenerannalkaE(klesce)tria

enmintinseasnetakjkmikremaknetealikliknetemb.

1 2 3

. iitezarezblizzrnjeakncakrva.ezzarezstavitealecinnat krvdvinitenavzrdaadstranite.

. Vreevstavitedtribaterijeinazitenaravilnlarnst.

3. krvritisnitevsmeriicdaaznvanamestite.

lvenina

Prilagaane.igralne.mike.ASUS.GX810.ROG

rilenisdrvkljjesebejnarejenrramkivamma nastavitevmikeX80inrabvsehnjenihfnkcij.sdrvstavitev tinininsleditenavdilmnazaslnzazanrrama.

efnkcijasamdejneazanaNImenarebrskajtevsebinjas driniitedattekset.exe.vkliknitezanamestitevrrama.

drbnanavdilalederilaajanjamikenajdetevrabnikemrirnik narilenemjsdr.

Conexin.a.un.PC

2

edealmacenarelrecetrBdentrdelratn. araahrrareneradesactivelaalimentacinmientrasnesttilizandel

ratn.

. rejemnikBvzemiteizrstraza Bnatastikalzavklzabiajn rabbrnitevlajzastandardni nainzabljiralnizknjav lajzairalninain.

. InserteelrecetrBenn ertBdisnible.

1

Prostor.za.klu.US

Ugasnen

Standardni. nain

Igralni.nain

l v

en

in a

KlikniteStart>All.Programs.Vsi.programi>ASUS.Gaming.Mouse.GX810. Igralna.mika.ASUS.GX810>ASUS.ROG.Gaming.Mouse.GX810.Igralna.mika. ASUS.ROG.GX810daserramzaene. esesdnjizaslnrikaeiralnmikAX80rikljitevvrataB ranalnikainklikniteOK.V.redudaserramnvnzaene.

Zagon.programa

Glavni.meni

3

6

7

8

11

17 18

4 5

10 9

1 2

1516 14 1213

19

23 24

22

21

20

lvenina

Elementi Opis

1. rikazjetrentnrabljeninainmike.

2. rikazjetrentnkaacitetbaterije.

3. Izberitefnkcijzavsakmb/vsakdejanjenasstnemseznam. *Zavedrbnstilejtetabelnanaslednjistrani.

4. Izberitelljivstnasstnemseznam. *aelementlahkknfiriratesamvIralnemnain.

5. vlecitedrsnikeeliteriladitihitrstdrsenja.

6. vlecitedrsnikeeliteriladitihitrstdvklika.

7. vkliknitetikneelitereverititrentnhitrstdvklika.

8. Klikniteeeliteshranitisremembeizbranearfila.

9. Kliknitezarabizbranearfila.

10. Kliknitedaizbrietesremembekistejihnarediliinzaretezasln.

11. Kliknitedashranitesremembekistejihnarediliinzaretezasln.

12. Kliknitezabnvitevzadnjihravljenihnastavitev.

13. Kliknitezariladitevbtljivstimike.

14. Obkljkajtedamitealinemitesreminjanjebtljivstimikes rilaajanjemvrednstisiXin/alisiY.

15. KliknitezarikazknaMacrettins(Makrnastavitve).Zadrbnstilejtestran 6.

16. Kliknitezarikazknareferences(riljbljenenastavitve).Zadrbnstilejte stran7.

17. Klikniteeelitestvaritinvrfil.

18. Kliknitezavzrfilaizvaearanalnika.

19. Kliknitezaizvzrfilavvaranalnik.

20. rikaehitrstsveevanja.

21. vklikniteimerfilaeaelitesremeniti.

22. Mdraikaleelementajeznakzaaktivnirfil.

23. Kliknitezadvjitevizbranearfila.

24. Kliknitezaizbrisizbranearfila. *Aktivnearfilanimnizbrisati.

l v

en

in a

Elementi Opis levi.gumb snemadelvanjestandardnealeveambamike.

desni.gumb snemadelvanjestandardneadesneambamike.

Gumb.za.drsene Kjeizbrantaelementritisnitembzastandardndrsenje.

Stikalo.DPI Kjeizbrantaelementritisnitestikaldaizberetelljivstmike. *amnstjerikazanasamvaminMde(Iralninain).

Strelane Kjeelementizbranritisnitetambzastreljanjevirahznaadis klikanjemkarjeistktebitrikratkliknililevimbmike.drbnsti silejtenastrani8.

Stran.napre Kjeizbrantaelementritisnitembdasemaknetenaled naslednjestranikarjeistktebiritisnili .

Stran.naza Kjeizbrantaelementritisnitembdasemaknetenaled rejnjestranikarjeistktebiritisnili .

Macro Kjeelementizbranritisnitembzazankazaaliserijekazvki jihlahkrejatesmjmenijaMacrrfileManaement(rejanje makrarfila).Za drbnsti lejte stran .

Zaeni.program Kjeizbrantaelementritisnitembzazanizbranearrama.Za drbnstilejtestran0.

Nastavitev.z.enim. dotikom

Kjeizbrantaelementritisnitembzazantearrama.

Mo.raunalnik KjeelementizbranritisnitetambdadreteknMymter(Mj ranalnik).

Internetni. brskalnik

Kjeelementizbranritisnitembzazanrivzeteasletnea brskalnika.

E-mail.Stranka Kjeelementizbranritisnitembzazanrivzeteatnea djemalca.

Drsi.levo/Drsi. desno

Kjeizbrantaelementritisnitembzadrsenjevlevalidesnkt klescezariladitevnaiba. *afnkcijadeljelevalikacijahMicrsftOfficeveracijskih

sistemihWinds7/Vista.

Nemo Kjeelementizbranzavklz.izklnainanemritisnitetamb.

Mediski. predvaalnik/ Predvaane/ prekinitev

Kjeizbrantaelementritisnitembzazanrivzeteamedijskea redvajalnika/zastavitevredvajanjavaktivnemmedijskem redvajalnik.

Aplikaciski. preklop

Kjeizbrantaelementritisnitembzareklaljanjemedalikacijami kiseizvajajkarjeistktebiritisnili .

Obrni-3D Kjeizbrantaelementritisnitembzareklaljanjemedknis fnkcijFli3(Obrni3). *afnkcijadeljeleveracijskemsistemWinds7.

lvenina

Meni.Makro.nastavitve

Elementi Opis

1. Klikniteeelitezaetisnematidarceinnvnkliknitezarekinitevsnemanja. *Zavsakrfillahksnametenajve40darcev.

2. Obkljkajteeeliterezretivseasvnezamikemeddarci.

3. rikaesnetedarceinasvnezamikemedsnemanjem.

4. Kliknitezamikr/dlizbranihdarcihaliasvnihzamikih.

5. Kliknitezavnsasvneazamika.

6. Klikniteeeliteizbratiasvnizamikkiaelitevnesti.

7. Klikniteeeliteizbratinainnavljanja. Enkrat.na.klik:.Izberitezaenkratnizvedbmakrrfilakkliknetembmike. Kliknite.za.ponovitev,.nato.pa.za.zaustavitev:.Izberiteeelitenvitiizvajanje

makrrfilakkliknetembmikeinzastavitevnvnkliknitembmike. Kliknite.za.ponovitev:.Izberiteklikkratelitenvitiizvajanjemakrrfilak

kliknetembmike.tevilnavljanjizberitenasstnemseznam. Pritisnen.za.ponavlane:.Izberiteeelitenvitiizvajanjemakrrfilak

dritembmikeinzastavitevmbmikesstite.

8. Klikniteeeliteshranitisremembeizbranearfila.

5

7

8

11 10 9

1 2

12

13 14

3

4

6

nadaljevanje na naslednji strani

15

nadaljevanjenanaslednjistrani

l v

en

in a

Elementi Opis

1. ObkljkajtedaserikaeiknaOvWindsNtificatinArea(drjeza bvestilaWinds).

2. Obkljkajtedamitefnkcijrikazanazasln.

3. Kliknitedashranitesremembekistejihnarediliinzaretezasln.

4. Kliknitedaizbrietesremembekistejihnarediliinzaretezasln.

Prilublene.meniu

3 4

2 1

Elementi Opis 9. Kliknitedaizbrietesremembekistejihnarediliinzaretezasln.

10. Kliknitedashranitesremembekistejihnarediliinzaretezasln.

11. Kliknitezaddelitevizbranearfilambmike.

12. Klikniteeelitestvaritinvmakrrfil.

13. Klikniteeeliteizbrisatiizbranimakrrfil.

14. Klikniteeelitedvjitiizbranimakrrfil.

15. vklikniteimerfilaeaelitesremeniti.

lvenina

Meni.Strelane

Elementi Opis

1. Kliknitezazanmenijatreljanje.

2. Klikniteeeliteizbratinainzastreljanje. Nain.3.rund:.Izberitezastreljanjevtrehrndahkkliknetembmike. Nain.5.rund:.Izberitezastreljanjevetihrndahkkliknetembmike. Nain.Samodeno:.Izberitezalnmasamdejnstreljanjekkliknetemb

mikeinstavitevbnvnemklik.

3. Kliknitedashranitesremembekistejihnarediliinzaretezasln.

4. Kliknitedaizbrietesremembekistejihnarediliinzaretezasln.

2

4 3

1

l v

en

in a

Meni.Makro.nastavitve

Elementi Opis

1. KliknitezazanmenijaMacrettins(Makrnastavitve).

2. Kliknitezaddelitevizbranearfilambmike.

3. Mdraikaleelementajeznakzaaktivnimakrrfil.

3

2

1

0

lvenina

Meni.Izbira.programa

Elementi Opis

1. Kliknitezazanmenijarramelectin(Izbirarrama).

2. Vnesiteimezablinjicrramakiaelitezanatikkliknetembmike.

3. Izberiterramkiaelitezanatikkliknetembmike.

4. Kliknitedaizbrietesremembekistejihnarediliinzaretezasln.

5. Kliknitedashranitesremembekistejihnarediliinzaretezasln.

2

3

1

5 4

l v

en

in a

1

Meni.Opravilne.vrstice

1

3 2

4 5 6

Elementi Opis

1. ejerramravilnnameensevravilnivrsticirikaeltiO.

2. Kliknitezazanlavneamenijatearrama.

3. KliknitezabiskAvearadneasletneamesta.

4. Kliknitedamite/nemitefnkcijrikazanazasln.

5. Kliknitezaizhdiztearrama.

6. Kliknitedareveriterazliicalikacijeinnilnika.

lvenina

Manual.del.usuario

Ratn.lser.para.gaming.ASUS. GX810.ROG

Esal

Informacin.de.contacto

ASUSTeK.COMPUTER.INC. micili 5ieadeitaieiaian5 elfn +886843447 Fax +88680778 ireccindecrreelectrnic inf@ass.cm.t itieb .ass.cm.t

Asistencia.tcnica elfn +86384 Asistenciaenlnea srt.ass.cm

ASUS.COMPUTER.INTERNATIONAL.Amrica micili 800rrateWayFremntA453A elfn +50733777 Fax +506084555 itieb sa.ass.cm

Asistencia.tcnica elfn +88787 Faxdeasistencia +8840883 Asistenciaenlnea srt.ass.cm

ASUS.COMPUTER.GmbH.Alemania.y.Austria micili arkrttr.340880atinenermany Fax +405 itieb .ass.de ntactenlnea .ass.de/sales

Asistencia.tcnica elfn(mnentes) +4805003* elfn(istemas/Eqisrttiles/ EqisEee/antallas) +4805000* Faxdeasistencia +405

*stedelallamada:04/mintdesdenalneadetelfnfijenAlemania;04/mint desdentelfnmvil..

Es a

l

mrebeqeelaqetedelratnlseraraaminAX00cntenals siientesartcls:

. Ratn lser para ASUS GX810 ROG. . . . . . Receptor.Nano.US.de.2,4.GHz . 3.x.pilas.AAA . Gua.de.inicio.rpido . CD.de.soporte

naseencntactcnsdistribidrsialndelsartclsanteriresfalta seencentradaad.

Contenido.del.paquete

Resumen.de.especificaciones

Nombre.del.modelo X80

Color Ner

Tecnologa.inalmbrica F4z

Sistemas.operativos. compatibles WindsX/WindsVista/Winds7

Dimensiones.mm atn:05()x66(W)x37() Peso atn:8(sinbatera)

otones./.Interruptores

xBtnizqierd/Btnderech/edadedeslazamient xedainclinableaizqierda/derecha x Btneslaterales xnmtadrdeI(slaraelMdamin)/

cnmtadrdealicacines(slaraelMdestndar) xnmtadrdeMddal

Resolucin

800/600/000/300di(ajstableslenelMdamin* *EnelMdestndarlareslcinesfijayeqivalea00

di.areslcinredeterminadaenelMddejees de300I.

Voltae.de.entrada .5V

ateras.necesarias ea3baterasAAA

asesecificacinesedenversesjetassjetasacambissinavisrevi.

Esal

Familiarcese.con.el.Ratn.lser.para.uegos.ASUS.GX810.ROG

ElatnaraaminAX80Oinclyenbtnizqierdnbtn derechnaredadedeslazamientdsbtneslateralesncnmtadrdeI yncnmtadrdeMddalcnndiseesecial.

1 Btnizqierd

2 Btnderech

3 edadedeslazamient/eda inclinable/indicadrdereslcin*

4

nmtadr de I (sl ara el Md deje) nmtadr de alicacines (sl ara

elMdestndar) 5 biertadelratn 6 tideO 7 Btneslaterales 8 Baseantideslizantedecach 9 jinesararatn 10 ensrlser 11 nmtadrdeMddal** 12 ecetcldelcnectrB 13 Receptor Nano USB de 2,4 GHz

Estado Resolucin ndestell 800di

sdestells 600di

resdestells 000di

atrdestells 300di

*. Indicadrdereslcin

Iconos Resolucin Aaad

Mdestndar

Mddeje

**. .nmtadrdeMddal

23 4

5

6 7

8

7

1

9

12 9

11 9

13

10

Es a

l

Instalacin de las bateras

asbaterassministradasnsnrecarables. iniensatilizarelratndranteneridrlnaddetiemextraia

lasbateras. tilicebaterasnevasdetisimilar. adqeelratnX80edefncinarcnnaslabateraessibleajstar

sesareandextrayendnadelasbaterasrestanteslasds. ialencenderelratnelniveldebateraesescaselindicadrEdeclr

naranja(sitadenlaredadedeslazamient)aradeardrantenminty seaaarinmediatamentealmverelratnhacerclicennbtn.

1 2 3

. Bsqelamescasitadaenelextremserirdelacbierta.lqeel larsbrelamescaylevantelacbiertaaraextraerla.

. Insertetresbaterasenlscmartimentsresetandlalaridadcrrecta.

3. resinelacbiertaenladireccinqeindicanlasflechasarainstalarlade nev.

Esal Personalizacin.del.Ratn.para.gaming.ASUS.GX810.ROG

Eldeaydainclidcntienenrramaesecialmentediseadaraaydarle acnfirarsX80defrmaqearvechealmximsscaractersticas.lqe eldeaydaenlanidadticaysialasinstrccinesenantallaarainiciarel rrama.

ilafncindeejeccinatmticaNOesthabilitadaeneleqiexamineel cnteniddeldesrteenbscadelarchivsetup.exe.aadbleclicenlara instalarelrrama. Encntrarinstrccinesmsdetalladasacercadelaersnalizacindelratnen elmanaldelsariinclideneldesrte.

Conexin a un PC

2

edealmacenarelrecetrBdentrdelratn. araahrrareneradesactivelaalimentacinmientrasnesttilizandelratn.

. ExtraiaelrecetrBdes recetclyclqeelinterrtrde encendidenlasicincrresndiente alMdestndaraminarasar elratnnrmalmenteenaqlla crresndientealMdaradisfrtar denmayrrendimientdranteels dejes.

. InserteelrecetrBenn ertBdisnible.

1

Receptculo.del.conector.US

Apagado

Modo. estndar

Modo.gaming

Es a

l

aaclicenStart.Inicio>All.Programs.Todos.los.programas>ASUS.Gaming. Mouse.GX810.Ratn.para.uegos.ASUS.GX810>ASUS.ROG.Gaming.Mouse. GX810.Ratn.para.gaming.ASUS.GX810.ROGarainiciarelrrama. iaarecelasiienteantallacnecteelatnarajesAX80anert BdeleqiyhaaclicenOK.Aceptararareiniciarelrrama.

Inicio del Programa

Men.principal

3

6

7

8

11

17 18

4 5

10 9

1 2

1516 14 1213

19

23 24

22

21

20

0

Esal

Elementos Descripcin 1. Mestraelmdenelqeseencentraensactalmenteelratn.

2. Mestraelnivelactaldebatera.

3. eleccinenafncin/accinaracadabtnenlalistadesleablecrresndiente. *nsltelatablainclidaenlainasiientesideseabtenermsinfrmacin.

4. eleccinenareslcinenlalistadesleable. *EstearmetrslseedecnfirarenelMdamin.

5. Arrastreestecntrldeslizantearaajstarlavelcidaddedeslazamient.

6. Arrastreestecntrldeslizantearaajstarlavelcidaddelaaccindedbleclic.

7. aadbleclicsbreesteicnaracmrbarlavelcidadasinadaalaaccinde dbleclic.

8. aaclicaqaraardarlscambisalicadsalerfilseleccinad.

9. aaclicaqaraalicarelerfilseleccinad.

10. aaclicaqaradescartarlscambisalicadsycerrarlaantalla.

11. aaclicaqaraardarlscambisalicadsycerrarlaantalla.

12. aaclicaqararestararlaltimacnfiracinalicada.

13. aaclicaqaraajstarlasensibilidaddelratn.

14. Activeestacasilladeverificacinarahabilitardeshabilitarlafncinqeermite mdificarlasensibilidaddelratnajstandlsvalresdelsejesXeY.

15. aaclicaqaraabrirlaventanaMacrettins(nfiracindemacrs).nslte laina6arabtenernainfrmacinmsdetallada.

16. aaclicaqaraabrirlaventanareferences(referencias).nslte la ina 7 arabtenernainfrmacinmsdetallada.

17. aaclicaqaracrearnerfilnev.

18. aaclicaqaraimrtarnerfilardadeneleqi.

19. aaclicaqaraexrtarnerfilaleqi.

20. Mestralatasadesnde.

21. aadbleclicenelnmbredenerfilaramdificarl.

22. Elntdeclrazlsitadjntalelementindicaqesetratadelerfilactiv.

23. aaclicaqaradlicarelerfilseleccinad.

24. aaclicaqaraeliminarelerfilseleccinad. *Elerfilactivnseedeeliminar.

Es a

l

1

Elementos Descripcin Botn izquierdo ermiteemlarelcmrtamientdelbtnrincialestndardelratn.

otn.derecho. ermiteemlarelcmrtamientdelbtnsecndariestndardenratn.

otn.de. desplazamiento

Alseleccinarestacinelbtncrresndienteermiteejectarlafncin dedeslazamientestndar.

Conmutador. de.DPI

Alseleccinarestacinelbtncrresndienteermiteseleccinarna reslcinaraelratn. *EstacinslestdisnibleenelMddeje.

Disparo.en.rfaga Alseleccinarestacinelbtncrresndienteermitellevaracabn disarenrfaa;estaaccinresltatilenjesenlsqeelataqese efectahaciendclicyeqivaleahacertrilecliccnelbtnrincialdel ratn.nsltelaina8sideseabtenermsinfrmacin.

Avanzar.pgina Alseleccinarestacinelbtncrresndienteermiteasaralaina siientedenrdeinas(eqivalealsar ).

Retroceder.pgina Alseleccinarestacinelbtncrresndienteermiteasaralaina anterirdenrdeinas(eqivalealsar ).

Macro Alseleccinarestacinelbtncrresndienteermiteejectarn cmandnaseriedecmandseditableatravsdelmenMacrrfile Manaement(Administracindeerfilesdemacr).nslte la ina ara btenernainfrmacinmsdetallada.

Iniciar.programa Alseleccinarestacinelbtncrresndienteermiteiniciarelrrama esecificad.nslte la ina 0 ara btener na infrmacin ms detallada.

Configuracin.de. pulsacin.nica

Alseleccinarestacinelbtncrresndienteermiteiniciareste rrama.

Mi.PC navezseleccinadlseelbtnaraabrirlaventanaMi.

Navegador.Web navezseleccinadlseelbtnarainiciarsnaveadreb reinstalad.

E-mail.Cliente navezseleccinadlseelbtnarainiciarsalicacindecrre electrnicreinstalada.

Desplazar.a.la. izquierda/derecha

Alseleccinarestacinelbtncrresndienteermitellevaracabn deslazamientalaizqierda/derechasimilaralqesecnsiealsarlareda inclinable. *Estafncinslesvlidaaralasalicacinesertenecientesalaqete

MicrsftOfficeenWinds7/Vista.

Silencio navezseleccinadlseelbtnaraactivar/desactivarelmd silenci.

Reproductor. Multimedia/ reproduccin/ pausa

Alseleccinarestacinelbtncrresndienteermiteiniciarel rerdctrmltimediaredeterminadrerdcir/efectarnaasaenel rerdctrmltimediaactiv.

Conmutador.de. aplicaciones

Alseleccinarestacinelbtncrresndienteermitealternarentrelas alicacinesenejeccin(eqivalealsar ).

Carrusel.3D Alseleccinarestacinelbtncrresndienteermitealternarentrelas ventanasabiertasemleandlafncinFli3(arrsel3). *EstafncinslesvlidaaraWinds7.

Esal

Men.Macro.Settings.Configuracin.de.macros

Elementos Descripcin 1. aaclicaqarainiciarlarabacindelasecenciadelsacines;haaclicde

nevaradetenerlarabacin. *ederabarnmximde40lsacinesrerfil.

2. Activeestacasilladeverificacinarainrarlasdiferenciasdetiementre lsacines.

3. Mestralaslsacinesrabadasylasdiferenciasdetiemreistradasdrante larabacin.

4. aaclicaqarasbir/bajarlaslsacinesdiferenciasdetiem seleccinadas.

5. aaclicaqarainsertarnadiferenciadetiem.

6. aaclicaqaraseleccinarelvalrdeladiferenciadetiemqedesee insertar.

7. aaclicaqaraseleccinarnmddereeticin. Una.vez.por.clic:eleccineestacinaraejectarelerfildemacrnavez

alhacercliccnelbtncrresndientedelratn. Un.clic.para.repetir.y.otro.clic.para.detener:eleccineestacinara

iniciarlareeticindeejeccinesdelerfildemacralhacercliccnelbtn crresndientedelratnydetenerlaalhacerclicdenevcnelmismbtn.

Un.clic.para.repetir:eleccineestacinaraestablecerelnmerdeveces qedeberreetirselaejeccindelerfildemacralhacercliccnelbtn crresndientedelratn.eleccinennmerdereeticinesenlalista desleable.

Repetir.al.mantener.pulsado:eleccineestacinarainiciarlareeticinde ejeccinesdelerfildemacralmantenerlsadelbtncrresndientedel ratnydetenerlaalliberarl.

8. aaclicaqaraardarlscambisalicadsalerfilseleccinad.

5

7

8

11 10 9

1 2

12

13 14

3

4

6

cntinaenlainasiiente

15

Es a

l

Elementos Descripcin 1. ActiveestacasilladeverificacinaraqesemestreelicndeOenelreade

ntificacindeWinds.

2. Activeestacasilladeverificacinarahabilitarlafncindemenenantalla.

3. aaclicaqaraardarlscambisalicadsycerrarlaantalla.

4. aaclicaqaradescartarlscambisalicadsycerrarlaantalla.

Men.Preferencias

3 4

2 1

Elementos Descripcin 9. aaclicaqaradescartarlscambisalicadsycerrarlaantalla.

10. aaclicaqaraardarlscambisalicadsycerrarlaantalla.

11. aaclicaqaraasinarelerfilseleccinadanbtndelratn.

12. aaclicaqaracrearnneverfildemacr.

13. aaclicaqaraeliminarelerfildemacrseleccinad.

14. aaclicaqaradlicarelerfildemacrseleccinad.

15. aadbleclicenelnmbredenerfilaramdificarl.

Esal

Men.urst.Fire.Disparo.en.rfaga

Elementos Descripcin 1. aaclicaqarainiciarelmenBrstFire(isarenrfaa).

2. aaclicaqaraseleccinarnmddedisarenrfaa. Modo.de.3.cartuchos:eleccineestacinaradisarartrescartchsalhacer

cliccnelbtncrresndientedelratn. Modo.de.5.cartuchos:eleccineestacinaradisararcinccartchsal

hacercliccnelbtncrresndientedelratn. Modo.automtico:eleccineestacinaradisararatmticamentealhacer

cliccnelbtncrresndientedelratnydetenerlaaccindedisaralhacer clicdenevcnelmismbtn.

3. aaclicaqaraardarlscambisalicadsycerrarlaantalla.

4. aaclicaqaradescartarlscambisalicadsycerrarlaantalla.

2

4 3

1

Es a

l

Men.Macro.Settings.Configuracin.de.macros

Elementos Descripcin 1. aaclicaqarainiciarelmenMacrettins(nfiracindemacrs).

2. aaclicaqaraasinarelerfilseleccinadanbtndelratn.

3. Elntdeclrazlsitadjntalelementindicaqesetratadelerfilde macractiv.

3

2

1

Esal

Men.Program.Selection.Seleccin.de.programas

Elementos Descripcin 1. aaclicaqarainiciarelmenrramelectin(eleccinderramas).

2. Intrdzcaaqelnmbredelaccesdirectdelrramaqedeseeejectaral hacercliccnelbtncrresndientedelratn.

3. eleccineelrramaqedeseeejectaralhacercliccnelbtn crresndientedelratn.

4. aaclicaqaradescartarlscambisalicadsycerrarlaantalla.

5. aaclicaqaraardarlscambisalicadsycerrarlaantalla.

2

3

1

5 4

Es a

l

Men.Taskbar.arra.de.tareas

1

3 2

4 5 6

Elementos Descripcin 1. ElltideOaareceenlabarradetareasnavezinstaladcrrectamente

elrrama.

2. aaclicaqarainiciarelmenrincialdeesterrama.

3. aaclicaqaravisitarelsitiebficialdeA.

4. aaclicaqarahabilitar/deshabilitarlafncindemenenantalla.

5. aaclicaqarasalirdeesterrama.

6. aaclicaqaracnsltarlasversinesdelaalicacinyelcntrladr.

Esal

Kullanm Klavuzu

ASUS GX810 ROG Lazerli Oyun Faresi

0

rke

rtibat.ilgileri

ASUSTeK.COMPUTER.INC. Adres 5ieadeitaieiaian5 elefn +886843447 Faks +88680778 Esta inf@ass.cm.t Websitesi .ass.cm.t

Teknik.Destek elefn +86384 Onlineyardm srt.ass.cm

ASUS.COMPUTER.INTERNATIONAL.Amerika Adres 800rrateWayFremntA453A elefn +50733777 Faks +506084555 Websitesi sa.ass.cm

Teknik.Destek elefn +88787 Yardmfaks +8840883 Onlineyardm srt.ass.cm

ASUS.COMPUTER.GmbH.Almanya ve Avusturya. . Adres arkrttr.340880atinenermany Faks +405 Websitesi .ass.de Onlineiletiim .ass.de/sales

Teknik.Destek elefn(ara) +4805003* elefn(istem/izstBilisayar/Eee/) +4805000* Yardmfaks +405 Onlineyardm srt.ass.cm

*.ir.Almanya.sabit.hattndan.arama.0.14.Euro/dakika;.cep.telefonundan.arama. 0.42.Euro/dakika.

rk

e

1

AX80OazerliOynFaresiaketinizdeaadakirnlerinbln blnmadnkntrledin.

. ASUS.GX810.ROG.Oyun.Faresi . Nano.US.2.4.GHz.alc . 3.x.AAA.pil . Hzl.alang.Klavuzu . Destek.CDsi

rnlerdenbirihasarrmseveyakaysamaazanziletemaskrn.

Paket.ierii

Teknik.zellik.zeti

Model.Ad X80

Renk iyah

Kablosuz.Teknoloi F4z

OS.destei WindsX/WindsVista/Winds7

oyutlar.mm Fare:05()x66(W)x37() Arlk Fare:8(ilsiz)

Dmeler./.Anahtarlar

xldmesi/admesi/nerteker xla/aaemetekeri xYandme xIanahtar(adeceOynMd)/ylamaanahtar

(adecetandartMd) xiftMdanahtar

znrlk

800/600/000/300di(sadeceOynMdnda ayarlanabilir)* *znrlktandartMdda00dideerinesabitlendi.

OynMdiinvarsaylanznrlk300didir. Giri.Gerilimi .5V

Pil.Gereksinimi den3ekadarAAAil

eknikzelliklerdencedenhaberverilmedendeiiklikyalabilir.

rke

ASUS.GX810ROG.Lazerli.Oyun.Farenizi.Tanyn

AX80OOynFarenizslsadmesidnertakeryanlardaikiadet dmebirIanahtarvezeltasarlanmiftMdanahtarilebirlikteelmektedir.

1 ldmesi

2 admesi

3 nerteker/Eimliteker/znrlk steresi*

4 I anahtar (adece Oyn Md) ylama anahtar (adece tandart

Md) 5 Farekaa 6 Ols 7 Yandme 8 Kaymaynleyenkaktasarm 9 Fareayaklar 10 azersensr 11 iftMdanahtar** 12 Bdnanmyvas 13 ASUS GX810 ROG Oyun Faresi

Durum Gstergeler Birkezyansner 800di

kikezyansner 600di

kezyansner 000di

rtkezyansner 300di

*. znrlk.gstergesi

Simgeler Gstergeler kaal

tandartMd

OynMd

**. ift.Mod.anahtar

23 4

5

6 7

8

7

1

9

12 9

11 9

13

10

rk

e

Pili takma

rnlebirlikteelenillerarjedilemez. Mseznsrekllanmayacaksanzillerikarn. Yeniveyaayntiteillerikllann. X80farenizsadecebirililealtndanbirveyaikiilekleyerekyada

kararakfarenizinarlnayarlayabilirsiniz. FarenincillerzayfkenaldndatrncE(kaydrmalteker)bir

dakikayansnecekvefarenizynatldndaveyabirdmeyetklandndaderhal kaanacaktr.

1 2 3

. Kaanstksmnayaknyerdekiirintiyibln.Baarmanzbirintiye yerletirinveardndankaaykarkaldrarakkarn.

. Yvalaraekadarilyerletirindrktntedin.

3. eitirmekiinkaakynndeyerletirin.

rke

ASUS.GX810.ROG.Oyun.Farenizin.zelletirilmesi

Birlikteverilendestek'sindeX80'ntmzelliklerindenfaydalanmakzere ayarlamanzsalayanzeltasarlanmbirrramblnr.estek'sinitik srcyeyerletirinverrambalatmakiinekranynereleriniylayn.

EerAtrnbilisayarnzdaetkinEEdesteksininieriinezatarak setup.exedsyasnbln.rramkrmakiinzerineifttklayn. Farenizinaslzelletireceinizhakkndaayrntlbiliiindesteksindeverilen

kllanmelkitabnabakn.

PCye.alama

2

Balcyfareniniindesaklayabilirsiniz. Elektriktasarrfiinmsekllanmadnzdaltfenckaatn.

. BalcsnByvasndankarn veardndandahaiyiyndeneyimi eldeetmekzereOynMdiin anahtarntandartMdaetirin.

. BalcsnbbirB rtnatakn.

1

US.donanm.yuvas

Kapal

Standart. Mod

Oyun.Modu

rk

e

Start.alat.>.All.Programs.Tm.programlar.>.ASUS.Gaming.Mouse.GX810. ASUS.Oyun.Faresi.GX810.>.ASUS.ROG.Gaming.Mouse.GX810.ASUS.ROG.Oyun. Faresi.GX810atklayarakrrambalatn. AadakiekranrnrseAX80OynfarenizibilisayarnznBbalant nktasnataknveardndanOK.Tamamatklayarakrramyenidenbalatn.

Program.alatma

Ana.men

3

6

7

8

11

17 18

4 5

10 9

1 2

1516 14 1213

19

23 24

22

21

20

rke

eler Aklama

1. Kllandnzmevctfaremdnsterir.

2. Mevctilseviyesinisterir.

3. ndirmelilistedenherdme/ilemiinbirilevsein. *Ayrntlbiliiinsnrakisayfadablnantablyabakn.

4. Alrlistedenznrlsein. *BesadeceOynMdndayalandrlabilirhaleelir.

5. Kaydrmahznayarlamakiinkaydrcysrkleyin.

6. ifttklamahznayarlamakiinkaydrcysrkleyin.

7. Bsimeyeifttklayarakmevctifttklamahzntestedin.

8. eilenrfildeyatnzdeiikliklerikaydetmekiintklayn.

9. eilenrfiliylamakiintklayn.

10. Yatnzdeiiklikleriyksaymakiintklaynveekrankaatn.

11. Yatnzdeiikliklerikaydetmekiintklaynveekrankaatn.

12. Yatnzsndeiikliklerieriyklemekiintklayn.

13. Farehassaslnayarlamakiintklayn.

14. FarehassaslnXve/veyaYeksenideerlerindeayarlayarakdeiiklikleri etkinletirmekyadaenellemekiintklayn.

15. MakrAyarlarenceresiniamakiintklayn.ahafazlaayrntiinsayfa6'yebakn.

16. ercihlerenceresiniamakiintklayn.ahafazlaayrntiinsayfa7'yebakn.

17. Yenibirrfilltrmakiintklayn.

18. Bilisayarnzdakibirrfiliieriaktarmakiintklayn.

19. Bilisayarnabirrfiliaktarmakiintklayn.

20. Oylamarannsterir.

21. eitirmekiinbirrfiladnaifttklayn.

22. eninyanndakimavibirnktaaktifrfilisterir.

23. eilenrfilikyalamakiintklayn.

24. eilenrfilisilmekiintklayn. *Aktifrfilsilinemez.

rk

e

eler Aklama Sol.dmesi. Fareninstandartsldmesinitakliteder.

Sa.dmesi. Fareninstandartsadmesinitakliteder.

Kaydrma.Dmesi eildiindedmeyebasarakstandartkaydrmaileviniyerineetirin.

DPI.Anahtar eildiindedmeyebasarakbirfareznrlsein. *BseeneksadeceOynMdndabelirir.

Seri.At klavesaldrynlardaseildiindeseriatyaarbatstandart fareninsldmesineikeztklamayaedeerdir.Ayrntlariinsayfa 8ebaknz.

Sonraki.Sayfa eildiindedmeyebasarakrntlediinizbirsnrakisayfayaidin bilem tlarnabasmayaedeerdir.

nceki.Sayfa eildiindedmeyebasarakrntlediinizbirncekisayfayaidin bilem tlarnabasmayaedeerdir.

Macro eildiindedmeyebasarakbirkmtveyakmtserisinialtrn bnMakrrfilYnetimmensndedzenleyebilirsiniz.ahafazla ayrntiinsayfa'yebakn

Program.alat eildiindedmeyebasarakbelirlediinizrrambalatn.aha fazlaayrntiinsayfa0'yebakn

Tek.Dokunma. Ayar

eildiindedmeyebasarakrrambalatn.

ilgisayarm eildiindeBilisayarmenceresiniamakiindmeyebasn.

Web.Taraycs eildiindevarsaylanebtaraycnzbalatmakzeredmeyebasn.

E-posta.stemci eildiindevarsaylanestaylamanzbalatmakzeredmeye basn.

Sola./.Saa.Kaydr eildiindedmeyebasarakeimlitekereresla/saakaydrn. *BilevsadeceWinds7/VistailetimsistemindeMicrsftOffice

ylamalarndaalr.

Sessiz eildiindesessessizmdnamak/kaatmakiindmeyebasn.

Ortam.Yrtcs/ reproduccin/ Pausa

eildiindedmeyebasarakvarsaylanrtamyrtcnzbalatn veyaaktifrtamyrtcnzdeyrtmeyiynatn/draklatn.

Uygulama. Anahtar

eildiindedmeyebasarakalanylamalararasndaeiyan b tlarnabasmakileayndr.

evir-3D eildiindedmeyebasarakevir3yikllanarakencereleri deitirin. *BilevsadeceWinds7dekllanlabilir.

rke

Makro.Ayarlar.mens

eler Aklama

1. vrlarnzkaydetmeyebalamakiintklaynvetekrartklayarakdrdrn. *errfiliinenfazla40tvrkaydedebilirsiniz.

2. vrlararasndakitmzamanecikmelerinizardetmekiintklayn.

3. Kaytsrasndakikaytltvrlarnvezamanecikmelerinisterir.

4. eilentvrlarnveyazamanecikmeleriniykar/aatamakiintklayn.

5. Zamanecikmesieklemekiintklayn.

6. Eklemekistediinizecikmezamannsemekiintklayn.

7. Yinelememdnsemekiintklayn. Tklama.bana.bir.kez:Faredmesinetkladnzdamakrrfiliniyerine

etirmekiintklayn. Yinelemek.iin.tklayn,.ardndan.tklayarak.durdurun:Faredmesine

tkladnzdavedmeyetekrartklayarakdrdrdnzdamakrrfilini yinelemeyisein.

Yinelemek.iin.tklayn:Faredmesinetkladnzdamakrrfiliniyinelemeyika kezyaacanzsein.Alrlistedentekrarlamasaysnsein.

Tekrarlamak.iin.basn:Faredmesinittarakvedrdrmakiindmeyibrakarak makrrfiliniyinelemeyisein.

8. eilenrfiledyatnzdeiikliklerikaydetmekiintklayn.

5

7

8

11 10 9

1 2

12

13 14

3

4

6

snrakisayfadadevam

15

rk

e

eler Aklama

1. WindsBildiriAlanndaOsimesinistermekiintklayn.

2. Ekrandasterirkenrntilevinietkinletirmekiintklayn.

3. Yatnzdeiikliklerikaydetmekiintklaynveekrankaatn.

4. Yatnzdeiiklikleriyksaymakiintklaynveekrankaatn.

Tercihler.mens

3 4

2 1

eler Aklama 9. Yatnzdeiiklikleriyksaymakiintklaynveekrankaatn.

10. Yatnzdeiikliklerikaydetmekiintklaynveekrankaatn.

11. eilenrfilibirfaredmesineatamakiinsein.

12. Yenibirmakrrfililtrmakiintklayn.

13. eilenmakrrfilinisilmekiintklayn.

14. eilenmakrrfilinikyalamakiintklayn.

15. eitirmekiinbirrfiladnaifttklayn.

0

rke

Seri.Ate.mens

eler Aklama

1. eriAtemensbalatmakiintklayn.

2. eriatemdnsemekiintklayn. 3.Rounds.Mode.Tur.Modu:Faredmesinetkladnzdatrateetmekiinsein. 5.Rounds.Mode.Tur.Modu:Faredmesinetkladnzdabetrateetmekiin

sein. Full.Automatic.Mode.Tam.Otomatik.Mod:Faredmesinetkladnzdave

drdrmakiintekrartkladnzdatmatikateetmesiiinsein.

3. Yatnzdeiikliklerikaydetmekiintklaynveekrankaatn.

4. Yatnzdeiiklikleriyksaymakiintklaynveekrankaatn.

2

4 3

1

rk

e

1

Makro.Ayarlar.mens

eler Aklama

1. MakrAyarlarmensbalatmakiintklayn.

2. eilenrfilibirfaredmesineatamakiinsein.

3. eninyanndakimavibirnktaaktifmakrrfilisterir.

3

2

1

rke

Program.Seme.mens

eler Aklama

1. rramsememensnbalatmakiintklayn.

2. Faredmesinetkladnzdaaltrmakistediinizrramnksayladnirin.

3. Faredmesinetkladnzdaaltrmakistediinizbirrramsein.

4. Yatnzdeiiklikleriyksaymakiintklaynveekrankaatn.

5. Yatnzdeiikliklerikaydetmekiintklaynveekrankaatn.

2

3

1

5 4

rk

e

Grev.ubuu.mens

1

3 2

4 5 6

eler Aklama

1. rramdryklendiindeOlsrevbndarnr.

2. Brramnanamensnbalatmakiintklayn.

3. Aresmiebsitesiniziyaretetmekiintklayn.

4. Ekrandasterilenrntilevinietkinletirmek/enellemekiintklayn.

5. Brramdankmakiintklayn.

6. ylamasrmnvesrcsrmnkntrletmekiintklayn.

rke

..

..ASUS.GX810.ROG

..

ASUSTeK.COMPUTER.INC. 5ieadeitaieiaian5 +886843447 +88680778 inf@ass.cm.t .ass.cm.t

. +86384 srt.ass.cm

ASUS.Technology.Pte..Ltd..

+38(044)545777 .ass.a

. +38(044)545777 srt.ass.cm

ASUS.COMPUTER.GmbH... arkrttr.340880atinenermany +405 .ass.de .ass.de/sales

. () +4805003* (/ //) +4805000* +405 srt.ass.cm

*04/;04/ .

AX80O :

. ..ASUS.GX810.ROG . -.US.2,4.

. 3.x.AAA . .... . CD.

.

..

.

. X80

. 4

..

WindsX/WindsVista/Winds7

.mm :05()x66()x37() : 8 ( )

/

// / I()/

()

800/600/000/300di()* *00di

. 300di.

. .5

.. 3

.

....ASUS.GX810.ROG

AX80O I .

1

2

3 / /*

4 I ( ) (

) 5 6 O 7 8 9 10 11 ** 12 B 13 B4

800di

600di

000di

300di

*. ..

**. ...

23 4

5

6 7

8

7

1

9

12 9

11 9

13

10

.

. . . X80

.

() .

1 2 3

. . .

. .

3. .

0

....ASUS.GX810.ROG

X80 . .

Atrn() setup.exe. . .

..

2

B. .

. BB .

. B B.

1

B

1

Start..>All.Programs...>ASUS.Gaming.Mouse. GX810...ASUS.GX810..>ASUS.ROG.Gaming.Mouse.GX810.. .ASUS.ROG.GX810. AX80 B.

.

.

3

6

7

8

11

17 18

4 5

10 9

1 2

1516 14 1213

19

23 24

22

21

20

1. .

2. .

3. /. *.

4. . *.

5. .

6. .

7. .

8. .

9. .

10. .

11. .

12. .

13. .

14. /Y.

15. ...6.

16. references(). . . 7.

17. .

18. .

19. .

20. .

21. .

22. .

23. .

24. . *.

. .

. .

.

.

.DPI . *.

. . . . 8.

..

.

.. .

MacrrfileManaement (). . . ..

. . . . 0.

. .

.

. My mter().

- .

. .

. /

/ . *MicrsftOfficeWinds7/Vista.

. /.

./ .

/ .

. .

Flip-3D Fli3. *Winds7.

...

1. . *40.

2. .

3. .

4. / .

5. .

6. .

7. . ..:.

. ,..,..,..:.

.

,..:. ..

,..:. .

8. .

5

7

8

11 10 9

1 2

12

13 14

3

4

6

15

1. OWinds.

2. .

3. .

4. .

.

3 4

2 1

9. .

10. .

11. .

12. .

13. .

14. .

15. .

..

1. .

2. . .3.:. .5.:. ..:

.

3. .

4. .

2

4 3

1

.-

1. .

2. .

3. .

3

2

1

..

1. .

2. .

3. .

4. .

5. .

2

3

1

5 4

..

1

3 2

4 5 6

1. O.

2. .

3. A.

4. /.

5. .

6.

Manualsnet FAQs

If you want to find out how the GX810 ASUS works, you can view and download the ASUS GX810 Mouse User Manual on the Manualsnet website.

Yes, we have the User Manual for ASUS GX810 as well as other ASUS manuals. All you need to do is to use our search bar and find the user manual that you are looking for.

The User Manual should include all the details that are needed to use a ASUS GX810. Full manuals and user guide PDFs can be downloaded from Manualsnet.com.

The best way to navigate the ASUS GX810 Mouse User Manual is by checking the Table of Contents at the top of the page where available. This allows you to navigate a manual by jumping to the section you are looking for.

This ASUS GX810 Mouse User Manual consists of sections like Table of Contents, to name a few. For easier navigation, use the Table of Contents in the upper left corner.

You can download ASUS GX810 Mouse User Manual free of charge simply by clicking the “download” button in the upper right corner of any manuals page. This feature allows you to download any manual in a couple of seconds and is generally in PDF format. You can also save a manual for later by adding it to your saved documents in the user profile.

To be able to print ASUS GX810 Mouse User Manual, simply download the document to your computer. Once downloaded, open the PDF file and print the ASUS GX810 Mouse User Manual as you would any other document. This can usually be achieved by clicking on “File” and then “Print” from the menu bar.